Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Mouse Monoclonal COX IV Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Goat, Hamster, Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal anti-CACNA1C Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-APP Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human APP

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Rabbit Polyclonal Anti-LRP1 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

ADAM17 mouse monoclonal antibody, clone 1F6

Applications ELISA, IF, IHC, PLA, WB
Reactivities Human

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

Rabbit Polyclonal APP Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APP antibody was raised against an 18 amino acid peptide near the amino terminus of human APP.

PEN2 (PSENEN) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PSENEN antibody was raised against synthetic peptide - KLH conjugated

NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A.

Rabbit Polyclonal APH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APH1 antibody was raised against a 18 amino acid peptide from near the center of human APH1.

Rabbit polyclonal PEK/PERK (Thr981) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PEK/PERK around the phosphorylation site of threonine 981 (R-H-TP-G-Q).
Modifications Phospho-specific

Rabbit polyclonal Neprilysin Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin.

Rabbit polyclonal Amyloid β A4 (Phospho-Thr743/668) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Amyloid β A4 around the phosphorylation site of threonine 743 (A-V-TP-P-E)
Modifications Phospho-specific

APP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen N term -peptide of human APP

Rabbit anti-MME Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MME

ATP2A1 (522-613) mouse monoclonal antibody, clone 1B11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1

TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A

Rabbit Polyclonal BACE2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BACE2 antibody was raised against a synthetic peptide corresponding to amino acids 44 to 59 of human BACE2.

Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H).
Modifications Phospho-specific

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.

Rabbit polyclonal anti-ATP5G3 antibody

Applications IF, IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP5G3.

COX7A2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50).

NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913).

Rabbit polyclonal NMDAR1 (Phospho-Ser890) antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR1 around the phosphorylation site of serine 890 (A-S-SP-F-K).
Modifications Phospho-specific

Rabbit polyclonal COX41 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human COX41.

Rabbit Polyclonal Anti-ATP2A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A1

IRE1 (ERN1) mouse monoclonal antibody, clone 3D1, Purified

Applications ELISA, IHC, WB
Reactivities Human

CD10 (MME) mouse monoclonal antibody, clone B-E3, Azide Free

Applications FC, FN, IHC
Reactivities Human

NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 860-910 of Human NMDAζ1.

COX4 (COX4I1) (154-166) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic peptide from C-term of human COX4I1

BACE2 (44-59) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen BACE2 antibody was raised against synthetic peptide (aptpgpgtpaerhadg) corresponding to amino acids 44 to 59 of human BACE2

NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide mapping at the N-terminus of NMDAR2B of human origin

TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Goat, Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211).

TNFRSF1A (20-43) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Immunogen TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1.

COX6A1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 50 - 78 amino acids from the Center region of human COX6A1

Rabbit Polyclonal APP Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APP antibody was raised against a peptide corresponding to 10 amino acids of human amyloid A4 protein precursor (APP) corresponding to the amino terminus of the 4K Ab peptide generated by beta- and gamma-secretases. The immunogen is located within amino acids 650 - 700 of APP.

Rabbit Polyclonal APP Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APP antibody was raised against a peptide corresponding to amino acids 737 to 751 of human amyloid A4 protein precursor (APP) or 85 to 99 of the C99 fragment generated by b-secretase cleavage. The peptide sequences are identical to those of monkey, mouse, rat, chicken, and a variety of other species .

Rabbit Polyclonal PEN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2.

Rabbit Polyclonal Nicastrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nicastrin antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human Nicastrin.