Germany
Japan
United Kingdom
China
Antibodies
Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit anti-SLC3A2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC3A2 |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Active filters
Reactivities
- Mouse
Applications
- IHC
Families
- Transmembrane
Filter by
Target Symbol
- ERBB2 (99)
- ABCB1 (85)
- APP (63)
- NCAM1 (55)
- BCL2 (51)
- NPR3 (50)
- PTPRE (47)
- POR (45)
- L1CAM (42)
- SYP (37)
- APMAP (35)
- GPR17 (35)
- EGFR (33)
- ILVBL (30)
- MTDH (30)
- UBE2J1 (30)
- SYT4 (27)
- FBXW7 (26)
- MME (26)
- ROR2 (26)
- RPN1 (26)
- SRPRB (26)
- CYP2A6 (25)
- PCDH7 (25)
- SEMA4D (25)
- SIL1 (25)
- ANO1 (24)
- HGF (22)
- HMOX2 (21)
- WNT3 (21)
- DDOST (20)
- FGG (20)
- IGSF11 (20)
- LGR5 (20)
- ERBB3 (19)
- BAX (18)
- MET (18)
- SLC7A8 (18)
- FGFR2 (17)
- BCL2L1 (16)
- CDH4 (16)
- CISD2 (16)
- GABRA5 (16)
- MRRF (16)
- PDIA4 (16)
- SSR1 (16)
- AIFM1 (15)
- CDH2 (15)
- LMAN1 (15)
- NTRK3 (15)
- PDGFRA (15)
- TMEM100 (15)
- PDCD1 (14)
- BNIP1 (12)
- GALNT10 (12)
- ITGB3 (12)
- SCAMP2 (12)
- SLC18A2 (12)
- ACVR2A (11)
- CPT1B (11)
- DPP10 (11)
- LRRTM1 (11)
- TMEFF2 (11)
- CISD1 (10)
- KCNJ3 (10)
- MLF2 (10)
- NDUFA4L2 (10)
- PCDHGC5 (10)
- ROMO1 (10)
- SDCBP (10)
- SPG7 (10)
- TYR (10)
- JAG1 (9)
- NTRK1 (9)
- NTRK2 (9)
- AQP1 (8)
- FGFR3 (8)
- FOLH1 (8)
- GRM4 (8)
- PDGFRB (8)
- SLC22A17 (8)
- TGFBR2 (8)
- ABCC5 (7)
- BDNF (7)
- CLDN3 (7)
- ERBB4 (7)
- NT5E (7)
- SEMA3D (7)
- TGFBI (7)
- VAPA (7)
- CAV1 (6)
- CERS2 (6)
- ENPEP (6)
- GRIA2 (6)
- GRM1 (6)
- KDR (6)
- MRC2 (6)
- NPTN (6)
- REEP2 (6)
- RNF144B (6)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (438)
- Focal adhesion (297)
- Calcium signaling pathway (289)
- Cytokine-cytokine receptor interaction (272)
- Neuroactive ligand-receptor interaction (272)
- Cell adhesion molecules (CAMs) (249)
- Prostate cancer (233)
- Metabolic pathways (228)
- Adherens junction (186)
- Endocytosis (182)
- Colorectal cancer (181)
- Pancreatic cancer (172)
- ErbB signaling pathway (166)
- Alzheimer's disease (149)
- Bladder cancer (146)
- MAPK signaling pathway (146)
- Endometrial cancer (138)
- Non-small cell lung cancer (136)
- Regulation of actin cytoskeleton (136)
- ABC transporters (129)
- Apoptosis (125)
- Axon guidance (124)
- Neurotrophin signaling pathway (118)
- Amyotrophic lateral sclerosis (ALS) (110)
- Melanoma (109)
- Hematopoietic cell lineage (107)
- Gap junction (92)
- Melanogenesis (79)
- Prion diseases (75)
- Small cell lung cancer (75)
- Parkinson's disease (67)
- Glioma (64)
- Wnt signaling pathway (64)
- Basal cell carcinoma (63)
- N-Glycan biosynthesis (63)
- Leukocyte transendothelial migration (60)
- Ubiquitin mediated proteolysis (58)
- Epithelial cell signaling in Helicobacter pylori infection (57)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (56)
- Jak-STAT signaling pathway (56)
- Dilated cardiomyopathy (55)
- Hedgehog signaling pathway (54)
- Huntington's disease (53)
- GnRH signaling pathway (50)
- Renal cell carcinoma (50)
- Renin-angiotensin system (47)
- Hypertrophic cardiomyopathy (HCM) (45)
- TGF-beta signaling pathway (43)
- Retinol metabolism (41)
- ECM-receptor interaction (40)
- Drug metabolism - cytochrome P450 (39)
- Toll-like receptor signaling pathway (39)
- Vascular smooth muscle contraction (37)
- Chemokine signaling pathway (36)
- Chronic myeloid leukemia (36)
- Tight junction (36)
- Dorso-ventral axis formation (35)
- Adipocytokine signaling pathway (34)
- Complement and coagulation cascades (32)
- SNARE interactions in vesicular transport (32)
- p53 signaling pathway (32)
- Drug metabolism - other enzymes (30)
- Long-term potentiation (30)
- Natural killer cell mediated cytotoxicity (28)
- Porphyrin and chlorophyll metabolism (28)
- Caffeine metabolism (27)
- Purine metabolism (25)
- Vibrio cholerae infection (25)
- Notch signaling pathway (24)
- PPAR signaling pathway (24)
- T cell receptor signaling pathway (24)
- Long-term depression (23)
- Lysosome (22)
- Viral myocarditis (21)
- Oxidative phosphorylation (20)
- Pathogenic Escherichia coli infection (20)
- Tyrosine metabolism (19)
- Cardiac muscle contraction (17)
- Fatty acid metabolism (17)
- O-Glycan biosynthesis (15)
- Oocyte meiosis (15)
- Taste transduction (15)
- Thyroid cancer (15)
- Metabolism of xenobiotics by cytochrome P450 (14)
- Progesterone-mediated oocyte maturation (14)
- Riboflavin metabolism (14)
- Antigen processing and presentation (13)
- Glycosphingolipid biosynthesis - lacto and neolacto series (12)
- Nicotinate and nicotinamide metabolism (12)
- Primary immunodeficiency (12)
- Pyrimidine metabolism (12)
- Type II diabetes mellitus (12)
- Arachidonic acid metabolism (11)
- Systemic lupus erythematosus (10)
- B cell receptor signaling pathway (9)
- Tryptophan metabolism (9)
- Allograft rejection (8)
- Autoimmune thyroid disease (8)
- Graft-versus-host disease (8)
- Keratan sulfate biosynthesis (8)
- Linoleic acid metabolism (8)
- RIG-I-like receptor signaling pathway (8)
- Type I diabetes mellitus (8)
- Chondroitin sulfate biosynthesis (7)
- Glutathione metabolism (7)
- Glycerolipid metabolism (7)
- Heparan sulfate biosynthesis (7)
- Sphingolipid metabolism (7)
- Asthma (6)
- Cytosolic DNA-sensing pathway (6)
- Fc gamma R-mediated phagocytosis (6)
- Glycerophospholipid metabolism (6)
- VEGF signaling pathway (6)
- Amino sugar and nucleotide sugar metabolism (5)
- Ether lipid metabolism (5)
- Protein export (5)
- Starch and sucrose metabolism (5)
- Androgen and estrogen metabolism (4)
- Biosynthesis of unsaturated fatty acids (4)
- Cell cycle (4)
- Glycine (4)
- Inositol phosphate metabolism (4)
- Insulin signaling pathway (4)
- Olfactory transduction (4)
- Phenylalanine metabolism (4)
- Primary bile acid biosynthesis (4)
- Steroid biosynthesis (4)
- serine and threonine metabolism (4)
- Acute myeloid leukemia (3)
- Arginine and proline metabolism (3)
- Fc epsilon RI signaling pathway (3)
- Histidine metabolism (3)
- NOD-like receptor signaling pathway (3)
- Pantothenate and CoA biosynthesis (3)
- Propanoate metabolism (3)
- Valine (3)
- leucine and isoleucine degradation (3)
- Ascorbate and aldarate metabolism (2)
- Cyanoamino acid metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Nitrogen metabolism (2)
- Pentose and glucuronate interconversions (2)
- Phosphatidylinositol signaling system (2)
- Selenoamino acid metabolism (2)
- Taurine and hypotaurine metabolism (2)
- C21-Steroid hormone metabolism (1)
- Glycosaminoglycan degradation (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Maturity onset diabetes of the young (1)
- O-Mannosyl glycan biosynthesis (1)
- Terpenoid backbone biosynthesis (1)
- beta-Alanine metabolism (1)