Germany
Japan
United Kingdom
China
GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Feline, Human, Mouse, Rat |
| Immunogen | Synthetic peptide sequence from the C-terminus of GAD |
Antibodies
View as table Download
Rabbit polyclonal GAD2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human GAD2. |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal HLA-B Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-CD80 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
CD28 mouse monoclonal antibody, clone B-T3, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
IL12A goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Human, Monkey |
| Immunogen | Synthetic peptide from human IL12A / p35 |
Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Hamster, Human, Porcine, Rat |
| Immunogen | Synthetic Human proinsulin |
IL12B mouse monoclonal antibody, clone 1-1A4, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 465 and 558 of GAD65 (Uniprot ID#Q05329) |
Anti-Human IL-1alpha Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-1alpha |
Insulin (INS) mouse monoclonal antibody, clone ISL-8J, Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Anti-Human sFas Ligand Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHO cell derived recombinant Human sFas Ligand. |
Anti-Human TNF-β Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human TNF-β (E.coli-derived) |
Mouse anti Insulin Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat, Pig |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Pathways
- Type I diabetes mellitus
Filter by
Category
Target Symbol
- HSPD1 (51)
- CD80 (31)
- GAD1 (23)
- TNF (19)
- IL1A (16)
- GZMB (15)
- IL2 (13)
- PRF1 (12)
- IL12A (9)
- INS (9)
- IL12B (8)
- SMURF2 (8)
- FASLG (6)
- HLA-DRB5 (6)
- IL1B (6)
- GAD2 (5)
- CD28 (4)
- IFNG (4)
- FAS (3)
- LTA (3)
- HLA-DMB (2)
- HLA-DPB1 (2)
- HLA-G (2)
- PTPRN (2)
- CD86 (1)
- CPE (1)
- HLA-A (1)
- HLA-B (1)
- HLA-DMA (1)
- HLA-DOA (1)
- HLA-F (1)
Reactivities
- Human (227)
- Mouse (97)
- Rat (93)
- Monkey (33)
- Dog (31)
- Hamster (5)
- Pig (5)
- Bovine (4)
- Primate (4)
- Chicken (3)
- Canine (2)
- Guinea Pig (2)
- Rabbit (2)
- Rhesus Monkey (2)
- Chimpanzee (1)
- Drosophila (1)
- Escherichia coli (1)
- Helicobacter pylori (1)
- Porcine (1)
- Salmonella Typhimurium (1)
- Sheep (1)
- Spinach (1)
- Trichinella spiralis (1)
- White Fly (1)
- Xenopus (1)
- Yeast (1)