Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Active filters
Reactivities
- Mouse
Applications
- IHC
Pathways
- Pathways in cancer
Filter by
Target Symbol
- MAP2K1 (173)
- ERBB2 (99)
- CTNNB1 (71)
- AKT1 (64)
- JUN (63)
- BCL2 (51)
- PIK3CG (51)
- MTOR (45)
- FOS (40)
- GLI1 (39)
- PIK3R5 (36)
- EGFR (33)
- STAT5A (32)
- MAPK1 (29)
- MLH1 (29)
- BRAF (28)
- MAPK9 (27)
- PIK3CD (27)
- HRAS (26)
- AR (25)
- RB1 (25)
- HGF (22)
- DAPK2 (21)
- PIK3CA (21)
- WNT3 (21)
- RALBP1 (20)
- BAX (18)
- FN1 (18)
- MAP2K2 (18)
- MET (18)
- ARNT (17)
- FGFR2 (17)
- JUP (17)
- MYC (17)
- PTK2 (17)
- BCL2L1 (16)
- CDKN2B (16)
- DVL2 (16)
- PTGS2 (16)
- TP53 (16)
- HDAC2 (15)
- PDGFRA (15)
- CASP3 (14)
- APC (13)
- GSTP1 (13)
- MAPK8 (13)
- RASSF1 (13)
- FH (12)
- IGF1 (12)
- NFKBIA (12)
- STAT3 (12)
- VEGFB (12)
- ARAF (11)
- GLI2 (11)
- MSH6 (11)
- RELA (11)
- STAT1 (11)
- CTBP2 (10)
- MMP2 (10)
- AKT2 (9)
- AKT3 (9)
- BAD (9)
- HSP90AB1 (9)
- IKBKG (9)
- MSH2 (9)
- NTRK1 (9)
- BID (8)
- CASP9 (8)
- FGFR3 (8)
- PDGFRB (8)
- RARA (8)
- SMAD3 (8)
- TGFBR2 (8)
- APPL1 (7)
- CHUK (7)
- FGF2 (7)
- MAPK3 (7)
- PPARD (7)
- PTEN (7)
- STAT5B (7)
- VHL (7)
- BIRC5 (6)
- EPAS1 (6)
- FOXO1 (6)
- HIF1A (6)
- HSP90AA1 (6)
- LAMA4 (6)
- LEF1 (6)
- NRAS (6)
- PRKCA (6)
- RALB (6)
- VEGFC (6)
- BMP4 (5)
- CDK6 (5)
- CTBP1 (5)
- EGLN2 (5)
- FGF13 (5)
- GSK3B (5)
- HDAC1 (5)
- JAK1 (5)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (2106)
- Protein Kinase (762)
- ES Cell Differentiation/IPS (695)
- Transcription Factors (539)
- Transmembrane (438)
- Secreted Protein (224)
- Stem cell - Pluripotency (174)
- Adult stem cells (140)
- Cancer stem cells (111)
- Stem cell relevant signaling - JAK/STAT signaling pathway (107)
- Embryonic stem cells (91)
- Stem cell relevant signaling - DSL/Notch pathway (84)
- Protease (62)
- Nuclear Hormone Receptor (48)
- Stem cell relevant signaling - Wnt Signaling pathway (44)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (33)
- Induced pluripotent stem cells (30)
- GPCR (10)
- Phosphatase (7)