HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Rabbit anti-XRCC5 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human XRCC5 |
Rabbit anti-BAK1 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human BAK1 |
PSMA3 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA3 |
Rabbit anti-MCM6 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MCM6 |
BCL2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human BCL2 |
Rabbit anti-RFC4 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RFC4 |
Rabbit anti-MCM5 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MCM5 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
Applications | ELISA, FC, IF, IHC, IP, WB |
Reactivities | Human, Rat |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Human |
HDAC2 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HDAC2 |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
CDK7 mouse monoclonal antibody, clone MO-1.1, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
PHGDH mouse monoclonal antibody, clone 4A3-1D6, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
NM23A (NME1) mouse monoclonal antibody, clone 1D7, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Hsp60 (HSPD1) goat polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
Immunogen | HSPD1 antibody was raised against recombinant human HSP60. |
Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010) |
MCM3 Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MCM3 |
KPNA2 Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KPNA2 |
MNAT1 Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MNAT1 |
Rabbit anti-LSM4 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LSM4 |
Rabbit anti-SMARCC1 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMARCC1 |
c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Mammalian |
p53 (TP53) mouse monoclonal antibody, clone B-P3, Azide Free
Applications | FC, IHC, IP, WB |
Reactivities | Human |
Rabbit polyclonal Anti-SET Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Mouse Monoclonal RPA70 Antibody
Applications | IF, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal KAP1 / TIF1 beta Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone 916
Applications | ELISA, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Hsp60 (HSPD1) mouse monoclonal antibody, clone SJ-60, Purified
Applications | IHC, IP, WB |
Reactivities | Chicken, Human, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Mammalian |
HSP90AB1 mouse monoclonal antibody, clone MBH90B, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Bovine, Human, Mouse |
Rabbit Polyclonal anti-HSPA9 antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Mouse Monoclonal Hsp60 Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal RPA32/RPA2 Antibody
Applications | IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Ku80 Antibody
Applications | IF, IP, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Mouse monoclonal Hsp90 complex Antibody
Applications | IP |
Reactivities | Human, Mouse, Rat, Rabbit. Not tested on other species |
Conjugation | Unconjugated |
Rabbit Polyclonal Ku80/XRCC5 Antibody
Applications | IP, WB |
Reactivities | Hamster, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to residues 419-440 LVYVQLPFMEDLRQYMFSSLKN] of the 80 kDa Ku80 protein. |
Mouse Monoclonal FEN-1 Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal RAD9A Antibody
Applications | IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal SIRT1 Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
c-Myc (MYC) mouse monoclonal antibody, clone 19C2, Agarose
Applications | IP |
Conjugation | Agarose |
Mouse Monoclonal anti-HSP90AB1 Antibody
Applications | IP |
Reactivities | Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-Mre11 antibody
Applications | IP |
Reactivities | Saccharomyces cerevisiae |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 578-590 of Saccharomyces cerevisiae (baker's yeast) Mre11 protein. |