Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Fibrillin 2 (FBN2) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Bovine, Human |
| Immunogen | Protein fragment containing glycine-rich domain of exon 10 of Human Fibrillin-2. |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-CD3E Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD3E |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Nogo A (RTN4) (Isoform 1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to the C-terminal of human Nogo-A |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Apolipoprotein B (APOB) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | ApoLipoprotein Type B was isolated from human plasma by density gradient centrifugation followed by HPLC purification, |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal Antibody against BNIP3L
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This BNIP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 152-187 amino acids from human BNIP3. |
Rabbit Polyclonal Anti-Human p75NTR(extracellular)
| Applications | FC, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CEEIPGRWITRSTPPE, corresponding to amino acid residues 188-203 of human p75NTR. Extracellular, stalk domain. |
TGF beta Receptor III (TGFBR3) sheep polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Chicken |
| Immunogen | Recombinant protein derived from the extracellular domain of the Chicken TGF-beta-III Receptor protein. |
Syntaxin 2 (STX2) (1-19) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Chicken, Drosophila, Hamster, Human, Insect, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | STX2 antibody was raised against rat syntaxin 2 synthetic peptide, corresponding to amino acid residues 1-19, conjugated to KLH. |
TRP 7 (TRPC7) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IP, WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_065122.1; NP_001161049.1; NP_001161048.1. |
TNFRSF1A (20-43) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1. |
Somatostatin Receptor 1 (SSTR1) rabbit polyclonal antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-hKV11.1 (HERG)
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG). Intracellular, C-terminus. |
Glucose Transporter GLUT3 (SLC2A3) rabbit polyclonal antibody, Serum
| Applications | IP, WB |
| Reactivities | Mouse, Rat |
| Immunogen | 13 amino acid synthetic C-terminal sequence of murine GLUT3, conjugated to KLH. |
Haptoglobin (HP) (alpha-2) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Freund’s complete adjuvant is used in the first step of the immunization. |
Eph receptor B1 (EPHB1) (SAM Region) sheep polyclonal antibody, Purified
| Applications | IP |
| Reactivities | Human |
| Immunogen | A GST fusion protein ephB1 (Elk receptor) -SAM corresponding to amino |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IP
Clonalities
- Polyclonal
Families
- Transmembrane
Filter by
Target Symbol
- BCHE (3)
- EPHB1 (3)
- ACPP (2)
- GUCA2B (2)
- KCNH2 (2)
- APOB (1)
- BAK1 (1)
- BAX (1)
- BCL2 (1)
- BCL2L1 (1)
- BMP2 (1)
- BNIP3L (1)
- CACNA1B (1)
- CAV2 (1)
- CD3E (1)
- CD40 (1)
- COX4I1 (1)
- CPT1A (1)
- CXCR2 (1)
- DIABLO (1)
- DSCAM (1)
- EGFR (1)
- FBN2 (1)
- HMOX1 (1)
- HP (1)
- ITGA4 (1)
- ITGAV (1)
- KIR2DL1 (1)
- LBR (1)
- NGFR (1)
- PDGFRA (1)
- PSEN1 (1)
- RHOT1 (1)
- RTN4 (1)
- SLC2A3 (1)
- SSTR1 (1)
- STX2 (1)
- TFRC (1)
- TGFB3 (1)
- TGFBR3 (1)
- TNFRSF1A (1)
- TRPA1 (1)
- TRPC7 (1)
Reactivities
Antibody Hosts
Conjugates
Pathways
- Cytokine-cytokine receptor interaction (8)
- Pathways in cancer (8)
- Focal adhesion (6)
- Colorectal cancer (5)
- Endocytosis (5)
- MAPK signaling pathway (5)
- Amyotrophic lateral sclerosis (ALS) (4)
- Apoptosis (4)
- Hematopoietic cell lineage (4)
- Neurotrophin signaling pathway (4)
- Regulation of actin cytoskeleton (4)
- Alzheimer's disease (3)
- Axon guidance (3)
- Calcium signaling pathway (3)
- Cell adhesion molecules (CAMs) (3)
- Dilated cardiomyopathy (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Pancreatic cancer (3)
- Prostate cancer (3)
- Small cell lung cancer (3)
- Adipocytokine signaling pathway (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Chronic myeloid leukemia (2)
- ECM-receptor interaction (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Gap junction (2)
- Glioma (2)
- Huntington's disease (2)
- Melanoma (2)
- Primary immunodeficiency (2)
- Riboflavin metabolism (2)
- TGF-beta signaling pathway (2)
- Acute myeloid leukemia (1)
- Adherens junction (1)
- Allograft rejection (1)
- Antigen processing and presentation (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Basal cell carcinoma (1)
- Bladder cancer (1)
- Cardiac muscle contraction (1)
- Cell cycle (1)
- Chemokine signaling pathway (1)
- Dorso-ventral axis formation (1)
- Endometrial cancer (1)
- ErbB signaling pathway (1)
- Fatty acid metabolism (1)
- GnRH signaling pathway (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Melanogenesis (1)
- Metabolic pathways (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Non-small cell lung cancer (1)
- Notch signaling pathway (1)
- Oxidative phosphorylation (1)
- PPAR signaling pathway (1)
- Parkinson's disease (1)
- Porphyrin and chlorophyll metabolism (1)
- Prion diseases (1)
- Renal cell carcinoma (1)
- SNARE interactions in vesicular transport (1)
- Systemic lupus erythematosus (1)
- T cell receptor signaling pathway (1)
- Taste transduction (1)
- Toll-like receptor signaling pathway (1)
- Type II diabetes mellitus (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)
- p53 signaling pathway (1)