Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
CDK7 mouse monoclonal antibody, clone MO-1.1, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Hsp60 (HSPD1) goat polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | HSPD1 antibody was raised against recombinant human HSP60. |
Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010) |
MCM3 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM3 |
KPNA2 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KPNA2 |
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
Rabbit anti-LSM4 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LSM4 |
Rabbit anti-SMARCC1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SMARCC1 |
c-Myc (MYC) mouse monoclonal antibody, clone IMD-3, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
| Applications | IF, IP, WB |
| Reactivities | Mammalian |
p53 (TP53) mouse monoclonal antibody, clone B-P3, Azide Free
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Mouse Monoclonal RPA70 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal KAP1 / TIF1 beta Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone 916
| Applications | ELISA, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
c-Myc (MYC) mouse monoclonal antibody, clone Myc.A7, Aff - Purified
| Applications | IF, IP, WB |
| Reactivities | Mammalian |
HSP90AB1 mouse monoclonal antibody, clone MBH90B, Aff - Purified
| Applications | IF, IP, WB |
| Reactivities | Bovine, Human, Mouse |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Mouse Monoclonal Hsp60 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal RPA32/RPA2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Ku80 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Mouse monoclonal Hsp90 complex Antibody
| Applications | IP |
| Reactivities | Human, Mouse, Rat, Rabbit. Not tested on other species |
| Conjugation | Unconjugated |
Mouse Monoclonal FEN-1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal RAD9A Antibody
| Applications | IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal SIRT1 Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
c-Myc (MYC) mouse monoclonal antibody, clone 19C2, Agarose
| Applications | IP |
| Conjugation | Agarose |
Mouse Monoclonal anti-HSP90AB1 Antibody
| Applications | IP |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-Mre11 antibody
| Applications | IP |
| Reactivities | Saccharomyces cerevisiae |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 578-590 of Saccharomyces cerevisiae (baker's yeast) Mre11 protein. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IP
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- RPA2 (37)
- SSB (30)
- CHEK2 (25)
- MYC (7)
- XRCC5 (5)
- HSP90AB1 (3)
- HSPD1 (3)
- BCL2 (2)
- CDK1 (2)
- TP53 (2)
- BAK1 (1)
- CCND1 (1)
- CDK7 (1)
- FEN1 (1)
- HDAC1 (1)
- HDAC2 (1)
- HSPA9 (1)
- KPNA2 (1)
- LSM4 (1)
- MCM3 (1)
- MCM5 (1)
- MCM6 (1)
- MNAT1 (1)
- MRE11 (1)
- NME1 (1)
- PHGDH (1)
- PSMA3 (1)
- RAD9A (1)
- RFC4 (1)
- RPA1 (1)
- SET (1)
- SIRT1 (1)
- SMARCC1 (1)
- TNNI3 (1)
- TRIM28 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Cell cycle (43)
- DNA replication (43)
- Nucleotide excision repair (41)
- Homologous recombination (39)
- Mismatch repair (39)
- Systemic lupus erythematosus (30)
- p53 signaling pathway (30)
- Pathways in cancer (17)
- Chronic myeloid leukemia (12)
- Colorectal cancer (12)
- Small cell lung cancer (12)
- Bladder cancer (10)
- Endometrial cancer (10)
- Thyroid cancer (10)
- Wnt signaling pathway (10)
- MAPK signaling pathway (9)
- Acute myeloid leukemia (8)
- Jak-STAT signaling pathway (8)
- Prostate cancer (8)
- ErbB signaling pathway (7)
- Non-homologous end-joining (7)
- TGF-beta signaling pathway (7)
- Progesterone-mediated oocyte maturation (5)
- RNA degradation (5)
- Amyotrophic lateral sclerosis (ALS) (4)
- Apoptosis (4)
- Huntington's disease (4)
- Neurotrophin signaling pathway (4)
- Antigen processing and presentation (3)
- Focal adhesion (3)
- Glioma (3)
- Melanoma (3)
- NOD-like receptor signaling pathway (3)
- Non-small cell lung cancer (3)
- Pancreatic cancer (3)
- Type I diabetes mellitus (3)
- Basal cell carcinoma (2)
- Gap junction (2)
- Metabolic pathways (2)
- Notch signaling pathway (2)
- Oocyte meiosis (2)
- Base excision repair (1)
- Cardiac muscle contraction (1)
- Dilated cardiomyopathy (1)
- Glycine (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Proteasome (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Spliceosome (1)
- Viral myocarditis (1)
- serine and threonine metabolism (1)