Germany
Japan
United Kingdom
China
Antibodies
Download
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Mouse monoclonal eRFP antibody, clone OTI7C8
| Applications | WB |
| Conjugation | Unconjugated |
USD 479.00
2 Weeks
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Rabbit Anti-Goat IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Goat IgG |
| Conjugation | Unconjugated |
| Immunogen | Goat IgG, whole molecule |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit polyclonal HAPLN1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAPLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-38 amino acids from the N-terminal region of human HAPLN1. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
USD 380.00
2 Weeks
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Active filters
Applications
- WB
Conjugates
- Unconjugated
Citations
- Yes
Filter by
Target Symbol
- GAPDH (15)
- SAMHD1 (10)
- CD4 (8)
- VEGFA (8)
- ACTB (7)
- CD19 (7)
- CDH2 (7)
- LGR5 (7)
- PECAM1 (7)
- VIM (7)
- CANX (6)
- CD274 (6)
- GBE1 (6)
- MAPK8 (6)
- MME (6)
- SH2D2A (6)
- SNAI1 (6)
- TP53 (6)
- ALK (5)
- BAX (5)
- BECN1 (5)
- CHGA (5)
- CTNNB1 (5)
- HSPA1A (5)
- KRT8 (5)
- MAPK1 (5)
- MMP2 (5)
- NCAM1 (5)
- SOX17 (5)
- ZEB1 (5)
- ADIPOQ (4)
- ALDH1A3 (4)
- ARNTL (4)
- CCN2 (4)
- CD163 (4)
- CD44 (4)
- CDX2 (4)
- DPP9 (4)
- ERBB2 (4)
- GATA4 (4)
- GBP5 (4)
- HIF1A (4)
- KEAP1 (4)
- LTA4H (4)
- MAGEA3 (4)
- MCL1 (4)
- MKI67 (4)
- MYC (4)
- NEU1 (4)
- NIT2 (4)
- NR4A3 (4)
- PARP1 (4)
- PDE10A (4)
- POSTN (4)
- PRRX1 (4)
- RELA (4)
- SLC7A8 (4)
- SNAI2 (4)
- SPP1 (4)
- SQSTM1 (4)
- TP63 (4)
- UNG (4)
- ABCG2 (3)
- AKT1 (3)
- ALDH1L1 (3)
- APOE (3)
- BCL2 (3)
- CD3E (3)
- CD63 (3)
- CD68 (3)
- CD8A (3)
- CDH1 (3)
- CDH3 (3)
- CDKN2A (3)
- DDK (FLAG) (3)
- DDX58 (3)
- EPAS1 (3)
- EPCAM (3)
- ERCC1 (3)
- FGF2 (3)
- GBA (3)
- GFAP (3)
- HK2 (3)
- HNRNPM (3)
- HSP90AA1 (3)
- HSPD1 (3)
- IDO1 (3)
- IL1B (3)
- IL6 (3)
- JAK2 (3)
- KRT18 (3)
- LAMB3 (3)
- LIMK1 (3)
- LOXL2 (3)
- MAPK3 (3)
- MGMT (3)
- MS4A1 (3)
- MX1 (3)
- MYD88 (3)
- NFKBIZ (3)
Reactivities
- Human (1528)
- Mouse (1051)
- Rat (933)
- Monkey (200)
- Dog (192)
- Bovine (34)
- Canine (29)
- Pig (21)
- Cow (14)
- Xenopus (13)
- Chicken (12)
- Porcine (10)
- Zebrafish (10)
- Hamster (9)
- Primate (8)
- Rabbit (6)
- Rhesus Monkey (6)
- Chimpanzee (4)
- Drosophila (4)
- X. tropicalis (4)
- Sheep (3)
- Feline (2)
- Goat (2)
- Guinea Pig (2)
- Avian (1)
- C. elegans (1)
- Chlamydomonas (1)
- Equine (1)
- Escherichia coli (1)
- Eukaryote (1)
- Helicobacter pylori (1)
- Mink (1)
- Murine (1)
- Salmonella Typhimurium (1)
- Spinach (1)
- Streptococcus Pyogenes (1)
- Tadpole (1)
- Trichinella spiralis (1)
- White Fly (1)
- Yeast (1)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Families
- Druggable Genome (1035)
- Transmembrane (422)
- Transcription Factors (215)
- ES Cell Differentiation/IPS (195)
- Secreted Protein (150)
- Protein Kinase (109)
- Protease (69)
- Stem cell - Pluripotency (64)
- Adult stem cells (47)
- Embryonic stem cells (33)
- GPCR (25)
- Induced pluripotent stem cells (25)
- Cancer stem cells (22)
- P450 (17)
- Nuclear Hormone Receptor (14)
- Phosphatase (13)
- Stem cell relevant signaling - DSL/Notch pathway (13)
- Ion Channels: Other (10)
- Stem cell relevant signaling - JAK/STAT signaling pathway (9)
- Ion Channels: Transient receptor potential (7)
- Stem cell relevant signaling - Wnt Signaling pathway (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)
- Ion Channels: Glutamate Receptors (3)
- Ion Channels: ATP Receptors (2)
- Ion Channels: Cys-loop Receptors (2)
- Ion Channels: Calcium (1)
- Ion Channels: Potassium (1)
Pathways
- Pathways in cancer (191)
- Metabolic pathways (171)
- Focal adhesion (105)
- MAPK signaling pathway (100)
- Pancreatic cancer (76)
- Colorectal cancer (75)
- Cell adhesion molecules (CAMs) (69)
- Prostate cancer (69)
- Neurotrophin signaling pathway (67)
- Alzheimer's disease (65)
- Regulation of actin cytoskeleton (63)
- Adherens junction (60)
- Toll-like receptor signaling pathway (58)
- Renal cell carcinoma (57)
- Chronic myeloid leukemia (56)
- Hematopoietic cell lineage (56)
- Apoptosis (54)
- Bladder cancer (53)
- Small cell lung cancer (53)
- Chemokine signaling pathway (51)
- Leukocyte transendothelial migration (51)
- Melanoma (51)
- Progesterone-mediated oocyte maturation (51)
- T cell receptor signaling pathway (51)
- Insulin signaling pathway (50)
- Endometrial cancer (48)
- VEGF signaling pathway (48)
- ErbB signaling pathway (47)
- Adipocytokine signaling pathway (45)
- Glioma (45)
- Huntington's disease (45)
- Endocytosis (43)
- Non-small cell lung cancer (42)
- Amyotrophic lateral sclerosis (ALS) (41)
- B cell receptor signaling pathway (41)
- Cytokine-cytokine receptor interaction (41)
- p53 signaling pathway (41)
- Wnt signaling pathway (40)
- NOD-like receptor signaling pathway (39)
- Natural killer cell mediated cytotoxicity (39)
- Glycolysis / Gluconeogenesis (38)
- Prion diseases (38)
- Fc epsilon RI signaling pathway (37)
- Antigen processing and presentation (36)
- Pathogenic Escherichia coli infection (36)
- Acute myeloid leukemia (35)
- Type II diabetes mellitus (35)
- Axon guidance (33)
- Cell cycle (33)
- Thyroid cancer (33)
- Viral myocarditis (33)
- Jak-STAT signaling pathway (32)
- Tight junction (32)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (30)
- Gap junction (30)
- GnRH signaling pathway (30)
- Lysosome (30)
- Primary immunodeficiency (30)
- Fc gamma R-mediated phagocytosis (29)
- mTOR signaling pathway (29)
- RIG-I-like receptor signaling pathway (28)
- Epithelial cell signaling in Helicobacter pylori infection (26)
- ECM-receptor interaction (25)
- Parkinson's disease (25)
- TGF-beta signaling pathway (25)
- Hypertrophic cardiomyopathy (HCM) (24)
- Dilated cardiomyopathy (23)
- Vascular smooth muscle contraction (23)
- Drug metabolism - cytochrome P450 (22)
- Purine metabolism (22)
- Ubiquitin mediated proteolysis (22)
- Cytosolic DNA-sensing pathway (21)
- Melanogenesis (21)
- Basal cell carcinoma (20)
- Calcium signaling pathway (20)
- Long-term depression (19)
- Metabolism of xenobiotics by cytochrome P450 (19)
- Neuroactive ligand-receptor interaction (19)
- Oocyte meiosis (19)
- Dorso-ventral axis formation (18)
- Type I diabetes mellitus (18)
- Arachidonic acid metabolism (17)
- Long-term potentiation (17)
- ABC transporters (16)
- Starch and sucrose metabolism (15)
- Tyrosine metabolism (15)
- Spliceosome (14)
- Systemic lupus erythematosus (14)
- Base excision repair (13)
- Complement and coagulation cascades (13)
- Graft-versus-host disease (13)
- PPAR signaling pathway (13)
- Vibrio cholerae infection (13)
- Retinol metabolism (12)
- Allograft rejection (11)
- Citrate cycle (TCA cycle) (11)
- Oxidative phosphorylation (11)
- Sphingolipid metabolism (11)
- Tryptophan metabolism (11)
- Arginine and proline metabolism (10)
- Fatty acid metabolism (10)
- Fructose and mannose metabolism (10)
- Cysteine and methionine metabolism (9)
- Histidine metabolism (9)
- Linoleic acid metabolism (9)
- Pyrimidine metabolism (9)
- Renin-angiotensin system (9)
- Alanine (8)
- Autoimmune thyroid disease (8)
- Cardiac muscle contraction (8)
- Galactose metabolism (8)
- RNA degradation (8)
- Regulation of autophagy (8)
- Valine (8)
- aspartate and glutamate metabolism (8)
- leucine and isoleucine degradation (8)
- Hedgehog signaling pathway (7)
- Inositol phosphate metabolism (7)
- Nucleotide excision repair (7)
- Other glycan degradation (7)
- Porphyrin and chlorophyll metabolism (7)
- Androgen and estrogen metabolism (6)
- Asthma (6)
- Phenylalanine metabolism (6)
- Phosphatidylinositol signaling system (6)
- beta-Alanine metabolism (6)
- Butanoate metabolism (5)
- Circadian rhythm - mammal (5)
- Glutathione metabolism (5)
- Maturity onset diabetes of the young (5)
- Notch signaling pathway (5)
- One carbon pool by folate (5)
- Proteasome (5)
- Amino sugar and nucleotide sugar metabolism (4)
- DNA replication (4)
- Drug metabolism - other enzymes (4)
- Fatty acid elongation in mitochondria (4)
- Folate biosynthesis (4)
- Methane metabolism (4)
- Mismatch repair (4)
- Nicotinate and nicotinamide metabolism (4)
- Nitrogen metabolism (4)
- Pantothenate and CoA biosynthesis (4)
- Pentose phosphate pathway (4)
- Primary bile acid biosynthesis (4)
- Propanoate metabolism (4)
- Pyruvate metabolism (4)
- Sulfur metabolism (4)
- Ascorbate and aldarate metabolism (3)
- Biosynthesis of unsaturated fatty acids (3)
- C21-Steroid hormone metabolism (3)
- Glycerophospholipid metabolism (3)
- Homologous recombination (3)
- Selenoamino acid metabolism (3)
- Taurine and hypotaurine metabolism (3)
- Caffeine metabolism (2)
- Ether lipid metabolism (2)
- Glycerolipid metabolism (2)
- Glycosaminoglycan degradation (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Keratan sulfate biosynthesis (2)
- N-Glycan biosynthesis (2)
- Olfactory transduction (2)
- Pentose and glucuronate interconversions (2)
- SNARE interactions in vesicular transport (2)
- Vitamin B6 metabolism (2)
- leucine and isoleucine biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- Fatty acid biosynthesis (1)
- Glycine (1)
- Heparan sulfate biosynthesis (1)
- Limonene and pinene degradation (1)
- Lysine degradation (1)
- Non-homologous end-joining (1)
- O-Glycan biosynthesis (1)
- RNA polymerase (1)
- Riboflavin metabolism (1)
- Ribosome (1)
- Steroid biosynthesis (1)
- Thiamine metabolism (1)
- alpha-Linolenic acid metabolism (1)
- serine and threonine metabolism (1)