Germany
Japan
United Kingdom
China
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
Antibodies
Download
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Adenosine Receptor A2a (ADORA2A) (full length) Mouse Monoclonal Antibody [Clone ID: 7F6-G5-A2 / 7F6]
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
| Applications | FC, IHC, WB |
| Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Glucagon Receptor (GCGR) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human Glucagon Receptor. |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Rat |
| Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin. |
P2Y9 (LPAR4) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 127-156 amino acids from the Central region of human P2RY9 / LPAR4 |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Porcine, Rat |
| Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Porcine, Rat |
| Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit polyclonal anti-SPR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-CALCRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40. |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Rabbit Polyclonal Anti-GPR68 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL |
Rabbit Polyclonal Anti-GPR52 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LOC684623 antibody is: synthetic peptide directed towards the middle region of Rat LOC684623. Synthetic peptide located within the following region: RARFPSHEVDASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESS |
ACKR3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 330-358 amino acids from the C-terminal region of Human CXCR7. |
Rabbit Polyclonal Antibody against OPRS1 (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This OPRS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 47-81 amino acids from the N-terminal region of human OPRS1. |
Rabbit polyclonal CALCR Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CALCR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids from the C-terminal region of human CALCR. |
Active filters
Applications
- WB
Families
- GPCR
Filter by
Target Symbol
- LGR5 (63)
- GPR83 (19)
- CXCR4 (13)
- GPR17 (13)
- F2R (11)
- LGR4 (11)
- SSTR3 (11)
- GPR26 (10)
- ADRA1B (9)
- ADRB2 (9)
- CASR (9)
- LPAR1 (9)
- CCR7 (8)
- CX3CR1 (8)
- P2RY2 (8)
- ADORA2A (7)
- CCR5 (7)
- CHRM1 (7)
- GRM3 (7)
- GRM4 (7)
- HTR1A (7)
- HTR5A (7)
- HTR7 (7)
- NPY1R (7)
- PTGER3 (7)
- S1PR1 (7)
- SSTR1 (7)
- SSTR4 (7)
- SSTR5 (7)
- ADRA1A (6)
- ADRA2A (6)
- AGTR1 (6)
- CCR3 (6)
- CCR8 (6)
- CNR2 (6)
- CXCR2 (6)
- DRD1 (6)
- GABBR1 (6)
- GRM7 (6)
- GRM8 (6)
- HCRTR1 (6)
- HTR2C (6)
- HTR4 (6)
- LPAR4 (6)
- MC2R (6)
- NTSR1 (6)
- ACKR3 (5)
- APLNR (5)
- AVPR1A (5)
- AVPR1B (5)
- BDKRB1 (5)
- CCR2 (5)
- CRHR1 (5)
- CXCR3 (5)
- CXCR6 (5)
- CYSLTR1 (5)
- EDNRA (5)
- EDNRB (5)
- FFAR1 (5)
- FPR1 (5)
- FPR2 (5)
- FZD2 (5)
- FZD4 (5)
- GHRHR (5)
- GHSR (5)
- GIPR (5)
- HRH2 (5)
- MC1R (5)
- MTNR1A (5)
- OPN3 (5)
- OPRM1 (5)
- PTGDR2 (5)
- PTGER2 (5)
- S1PR3 (5)
- SSTR2 (5)
- TSHR (5)
- ACKR4 (4)
- ADGRE5 (4)
- ADORA1 (4)
- ADRA2C (4)
- ADRB1 (4)
- BDKRB2 (4)
- BRS3 (4)
- CCKBR (4)
- CCR4 (4)
- CHRM5 (4)
- CNR1 (4)
- DRD4 (4)
- F2RL3 (4)
- FZD1 (4)
- FZD9 (4)
- GABBR2 (4)
- GNRHR (4)
- GPER1 (4)
- GPR142 (4)
- GPR15 (4)
- GPR174 (4)
- GPR27 (4)
- GPR3 (4)
- GPR34 (4)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (635)
- Calcium signaling pathway (204)
- Chemokine signaling pathway (76)
- Cytokine-cytokine receptor interaction (76)
- Endocytosis (56)
- Vascular smooth muscle contraction (52)
- Melanogenesis (38)
- Gap junction (37)
- Regulation of actin cytoskeleton (34)
- Basal cell carcinoma (28)
- Colorectal cancer (28)
- Pathways in cancer (28)
- Wnt signaling pathway (28)
- Complement and coagulation cascades (25)
- Olfactory transduction (16)
- Axon guidance (13)
- Leukocyte transendothelial migration (13)
- Long-term depression (12)
- Renin-angiotensin system (12)
- Epithelial cell signaling in Helicobacter pylori infection (9)
- Long-term potentiation (7)
- Taste transduction (7)
- Autoimmune thyroid disease (5)
- Dilated cardiomyopathy (4)
- GnRH signaling pathway (4)
- Huntington's disease (4)
- Parkinson's disease (3)