Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
Carrier-free (BSA/glycerol-free) LGR4 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit anti-CXCR3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CXCR3 |
USD 440.00
2 Weeks
Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified
Applications | FC, IHC, WB |
Reactivities | Canine, Guinea Pig, Human, Mouse, Rabbit, Rat |
Rabbit Polyclonal Anti-OR51E2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Rabbit Polyclonal Anti-P2Y1 Receptor (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide SDEYLRSYFIYSMC, corresponding to amino acid residues 207-220 of human P2Y1 Receptor. 2nd extracellular loop. |
Glucagon Receptor (GCGR) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human Glucagon Receptor. |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Rat |
Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Goat Polyclonal Antibody against HCRTR1
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1. |
Rabbit Polyclonal Anti-ADORA2B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal S1P1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Rabbit Polyclonal Anti-GPR161 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE |
Rabbit Polyclonal Anti-CASR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CASR antibody was raised against a 15 amino acid peptide near the amino terminus of human CASR. |
Rabbit Polyclonal Anti-TRIP12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRIP12 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human TRIP12. |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin. |
P2Y9 (LPAR4) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 127-156 amino acids from the Central region of human P2RY9 / LPAR4 |
Rabbit Polyclonal Anti-P2Y12 Receptor (extracellular)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Immunogen | Peptide CTAENTLFYVKES, corresponding to amino acid residues 270-282 of human P2Y12 receptor. 3rd extracellular loop. |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6 |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
Mu Opioid Receptor (OPRM1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | KLH conjugated synthetic peptide between 161-187 amino acids from the Center region of human OPRM1 |
5 HT 2A (HTR2A) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against Bradykinin receptor B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2. |
Rabbit Polyclonal CXCR4 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal AGTR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1. |
Rabbit polyclonal anti-SPR1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPR1. |
Rabbit anti-SIGMAR1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal CCR1 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was raised against a synthetic peptide of human CCR1 protein. |
Rabbit Polyclonal Anti-FZD9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-CALCRL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
GPR40 (FFAR1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human GPR40. |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Rabbit Polyclonal MAS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human MAS1 protein (between residues 75-125) [UniProt P04201] |
Rabbit polyclonal anti-FZD2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD2. |
Rabbit polyclonal anti-FZD9 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9. |
Rabbit polyclonal Encephalopsin antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Encephalopsin. |
Rabbit Polyclonal GLP-1R Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220] |
Rabbit Polyclonal Anti-GPR68 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL |
Rabbit Polyclonal Anti-GPR52 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LOC684623 antibody is: synthetic peptide directed towards the middle region of Rat LOC684623. Synthetic peptide located within the following region: RARFPSHEVDASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESS |
ACKR3 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 330-358 amino acids from the C-terminal region of Human CXCR7. |
Rabbit Polyclonal Antibody against OPRS1 (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This OPRS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 47-81 amino acids from the N-terminal region of human OPRS1. |
Rabbit Polyclonal CCR3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3. |
Rabbit Polyclonal GPR3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPR3 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human GPR3. |
Rabbit Polyclonal MC4R Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MC4R antibody was raised against a 19 amino acid peptide near the amino terminus of human MC4R. |
Rabbit polyclonal anti-CRHR1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CRHR1. |
Rabbit polyclonal CALCR Antibody (C-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CALCR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids from the C-terminal region of human CALCR. |