Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal antibody to PSAT1 (phosphoserine aminotransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 328 of PSAT1 (Uniprot ID#Q9Y617) |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
| Applications | FC, IHC, WB |
| Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
Mouse monoclonal Hsp70/Hsc70 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit Polyclonal IRE1 alpha [p Ser724] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit (Does not react with: Primate) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 724 of the human IRE1 alpha protein. [Swiss-Prot #O75460] |
USD 430.00
2 Weeks
USD 424.00
In Stock
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit polyclonal ARRB1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARRB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-363 amino acids from the C-terminal region of human ARRB1. |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Transferrin (TF) (N-term) mouse monoclonal antibody, clone HTF-14, Aff - Purified
| Applications | ELISA, FN, IF, WB |
| Reactivities | Human, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against RPS6KB1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This S6K (RPS6KB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-306 amino acids from the Central region of human S6K (RPS6KB1). |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
USD 424.00
In Stock
Rabbit polyclonal ACTA1/Alpha-actin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACTA1/Alpha-actin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-375 amino acids from the C-terminal region of human ACTA1/Alpha-actin. |
Rabbit polyclonal CTNA1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CTNA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-59 amino acids from the N-terminal region of human CTNA1. |
Rabbit polyclonal SCP2 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Mouse Monoclonal Anti-Vinculin Antibody [7E10]
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone 810
| Applications | ELISA, IP, WB |
| Reactivities | Bovine, Canine, Feline, Goat, Human, Porcine, Rabbit |
| Conjugation | Unconjugated |
GAPDH mouse monoclonal antibody, clone H8, Purified
| Applications | ELISA, WB |
| Reactivities | Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against APOE (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APOE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the C-terminal region of human APOE. |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Active filters
Reactivities
- Rabbit
Applications
- WB
Filter by
Category
Target Symbol
- GAPDH (7)
- ACTB (5)
- CANX (5)
- TP53 (4)
- HSPD1 (3)
- PDCD1 (3)
- RPS6KB1 (3)
- VCL (3)
- ACTA1 (2)
- C5AR1 (2)
- CD44 (2)
- CSNK2A1 (2)
- DCN (2)
- HNRNPM (2)
- HPRT1 (2)
- HSPA1A (2)
- HSPA5 (2)
- HSPA8 (2)
- MAP2K1 (2)
- PDIA3 (2)
- PITPNA (2)
- PPP3CB (2)
- SEPTIN5 (2)
- SYNTAXIN (2)
- TCP1 (2)
- TMED10 (2)
- TUBA1A (2)
- ACHE (1)
- ACOX2 (1)
- ADRA1A (1)
- AKT2 (1)
- ALDOA (1)
- ALOX5 (1)
- ANGPT1 (1)
- ANXA1 (1)
- APOE (1)
- ARRB1 (1)
- ATP1A1 (1)
- ATP1B1 (1)
- ATP1B3 (1)
- BLMH (1)
- BPGM (1)
- CACNA1S (1)
- CALR (1)
- CAPN1 (1)
- CASP3 (1)
- CASQ2 (1)
- CASR (1)
- CAV2 (1)
- CCT2 (1)
- CD28 (1)
- CD4 (1)
- CELF1 (1)
- CKB (1)
- CLCN2 (1)
- CLCN5 (1)
- CNP (1)
- COMMD3-BMI1 (1)
- CORO1B (1)
- CSNK2B (1)
- CTNNA1 (1)
- DDC (1)
- EIF2B2 (1)
- EIF2B4 (1)
- EIF4G2 (1)
- EPHX1 (1)
- ERN1 (1)
- ETFDH (1)
- F11 (1)
- F9 (1)
- FKBP5 (1)
- FPGT (1)
- FPGT-TNNI3K (1)
- GM2A (1)
- GPX2 (1)
- GRM2 (1)
- HIF1A (1)
- HNRNPK (1)
- HRH3 (1)
- HSF2 (1)
- HSP90AA1 (1)
- HSP90AB1 (1)
- HSP90B1 (1)
- HSPE1 (1)
- IGF1 (1)
- KCNA2 (1)
- KCNC1 (1)
- KDELR1 (1)
- MAPK14 (1)
- MFN2 (1)
- MME (1)
- MPP1 (1)
- NCF1 (1)
- NDUFS1 (1)
- NDUFS2 (1)
- NR3C1 (1)
- OPCML (1)
- OR51E1 (1)
- PLN (1)
- PMS1 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
- Phospho-specific (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (117)
- Transmembrane (41)
- ES Cell Differentiation/IPS (20)
- Secreted Protein (16)
- Stem cell - Pluripotency (15)
- Transcription Factors (13)
- Protein Kinase (11)
- Phosphatase (7)
- Protease (7)
- GPCR (6)
- Adult stem cells (2)
- Ion Channels: Other (2)
- Ion Channels: Potassium (2)
- Nuclear Hormone Receptor (2)
- Induced pluripotent stem cells (1)
- Ion Channels: Calcium (1)
- Ion Channels: Transient receptor potential (1)
Pathways
- Metabolic pathways (22)
- Focal adhesion (18)
- Alzheimer's disease (17)
- Antigen processing and presentation (17)
- Pathways in cancer (16)
- MAPK signaling pathway (15)
- Regulation of actin cytoskeleton (13)
- Leukocyte transendothelial migration (12)
- Adherens junction (11)
- T cell receptor signaling pathway (11)
- Tight junction (11)
- Glycolysis / Gluconeogenesis (9)
- Pathogenic Escherichia coli infection (9)
- Prostate cancer (9)
- Wnt signaling pathway (9)
- Dilated cardiomyopathy (8)
- Insulin signaling pathway (8)
- Viral myocarditis (8)
- mTOR signaling pathway (8)
- Amyotrophic lateral sclerosis (ALS) (7)
- Apoptosis (7)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- Fc gamma R-mediated phagocytosis (7)
- Hypertrophic cardiomyopathy (HCM) (7)
- Oocyte meiosis (7)
- Pancreatic cancer (7)
- Prion diseases (7)
- Progesterone-mediated oocyte maturation (7)
- Renal cell carcinoma (7)
- Spliceosome (7)
- TGF-beta signaling pathway (7)
- Acute myeloid leukemia (6)
- Bladder cancer (6)
- Chemokine signaling pathway (6)
- Colorectal cancer (6)
- Endometrial cancer (6)
- ErbB signaling pathway (6)
- Glioma (6)
- Huntington's disease (6)
- Melanoma (6)
- Neuroactive ligand-receptor interaction (6)
- Neurotrophin signaling pathway (6)
- VEGF signaling pathway (6)
- Vascular smooth muscle contraction (6)
- Vibrio cholerae infection (6)
- B cell receptor signaling pathway (5)
- Calcium signaling pathway (5)
- Cell adhesion molecules (CAMs) (5)
- Chronic myeloid leukemia (5)
- Endocytosis (5)
- Long-term potentiation (5)
- Natural killer cell mediated cytotoxicity (5)
- Non-small cell lung cancer (5)
- Toll-like receptor signaling pathway (5)
- Cardiac muscle contraction (4)
- Fc epsilon RI signaling pathway (4)
- Gap junction (4)
- GnRH signaling pathway (4)
- Long-term depression (4)
- NOD-like receptor signaling pathway (4)
- Parkinson's disease (4)
- Thyroid cancer (4)
- Type I diabetes mellitus (4)
- p53 signaling pathway (4)
- Arachidonic acid metabolism (3)
- Axon guidance (3)
- Basal cell carcinoma (3)
- Complement and coagulation cascades (3)
- Melanogenesis (3)
- Primary immunodeficiency (3)
- RNA degradation (3)
- Small cell lung cancer (3)
- Adipocytokine signaling pathway (2)
- Cell cycle (2)
- Cytokine-cytokine receptor interaction (2)
- Dorso-ventral axis formation (2)
- Drug metabolism - other enzymes (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Fructose and mannose metabolism (2)
- Hematopoietic cell lineage (2)
- Oxidative phosphorylation (2)
- PPAR signaling pathway (2)
- Primary bile acid biosynthesis (2)
- Purine metabolism (2)
- SNARE interactions in vesicular transport (2)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Arginine and proline metabolism (1)
- Autoimmune thyroid disease (1)
- Base excision repair (1)
- ECM-receptor interaction (1)
- Glutathione metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycine (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Histidine metabolism (1)
- Jak-STAT signaling pathway (1)
- Lysosome (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Olfactory transduction (1)
- Pentose phosphate pathway (1)
- Phenylalanine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Renin-angiotensin system (1)
- Starch and sucrose metabolism (1)
- Systemic lupus erythematosus (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Ubiquitin mediated proteolysis (1)
- Vitamin B6 metabolism (1)
- serine and threonine metabolism (1)