USD 380.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRNA4 |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRNA4 |
GABRA2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRA2 |
Rabbit Polyclonal Anti-GABRA5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit anti-CHRNB1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRNB1 |
Goat Anti-CHRNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVDRYFTQKEET, from the internal region of the protein sequence according to NP_000736.2. |
Rabbit polyclonal anti-GLRB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLRB. |
Anti-HTR3A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic |
CHRNA5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRNA5 |
Rabbit anti-GLRA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human GLRA1 |
USD 585.00
3 Weeks
Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha 4 (extracellular
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DLVNMHSRVDQLD, corresponding to amino acid residues 190-202 of human nAChRa4. Extracellular, N-terminus. |
Rabbit anti-GABRB2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRB2 |
Rabbit anti-CHRNA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRNA1 |
Rabbit anti-HTR3A Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HTR3A |
Rabbit anti-GABRR1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRR1 |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GABRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human GABRG2. Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME |
Rabbit Polyclonal Anti-GABRG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRG1 Antibody: A synthesized peptide derived from human GABRG1 |
GABA A Receptor beta 3 (GABRB3) (400-411) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Canine, Equine, Hamster, Human, Monkey, Mouse, Rat |
Immunogen | Synthetic peptide from an internal region of human GABRB3 (NP_000805.1; NP_068712.1) |
GABA A Receptor alpha 4 (GABRA4) (349-361) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human GABRA4 (NP_000800.2) |
5HT3A receptor (HTR3A) (428-439) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human HTR3A |
Goat Polyclonal Antibody against Serotonin receptor 3A / HTR3A
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GPQDFEKSPRDR, from the internal region of the protein sequence according to NP_998786.1; NP_000860.1. |
Rabbit polyclonal antibody to alpha 2 Glycine Receptor (glycine receptor, alpha 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 216 of Glycine Receptor alpha 2 (Uniprot ID#P23416) |
Rabbit polyclonal anti-5-HT-3A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-3A. |
Rabbit polyclonal anti-GABRA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA4. |
Rabbit polyclonal anti-CHRNA10 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CHRNA10. |
Rabbit polyclonal CHRNA3 Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CHRNA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 25-52 amino acids from the N-terminal region of human CHRNA3. |
Rabbit polyclonal GABRA2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434 |
Modifications | Phospho-specific |
Rabbit Polyclonal GABA-RB Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB |
Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-CHRND Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
Rabbit Polyclonal Anti-GABRP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit Polyclonal 5-HT3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563. |
Rabbit Polyclonal Anti-HTR3B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence C-EKTAKAKNDRSK, from the internal region of the protein sequence according to NP_000805.1; NP_068712.1. |
GABA A Receptor gamma 2 (GABRG2) (400-410) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_944494.1; NP_000807.2; NP_944493.2. |
5HT3A receptor (HTR3A) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
USD 440.00
2 Weeks
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Canine, Chicken, Equine, Human, Monkey, Porcine |
Immunogen | Synthetic peptide from an internal region of human CHRNA7 (NP_000737.1) |
CHRNA1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of Human CHRNA1, identical to the related Rat and Mouse sequence |
GABA A Receptor beta 1 (GABRB1) (1-226) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 226 of Human GABA A Receptor beta 1 |
5HT3E (HTR3E) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 133-162 amino acids from the Central region of human 5HT3E. |
CHRNA10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 186-214 amino acids from the Central region of human CHRNA10 |
CHRNA2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 49-77 amino acids from the N-terminal region of human CHRNA2 |
CHRND (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 175-204 amino acids from the Central region of human CHRND |
USD 375.00
5 Days
Goat Anti-CHRNB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1. |
Rabbit polyclonal anti-CHRNB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CHRNB1. |
Anti-CHRNA10 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 360-373 amino acids of human cholinergic receptor, nicotinic, alpha 10 (neuronal) |
Rabbit Polyclonal Anti-HTR3A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV |
Rabbit Polyclonal Anti-CHRNA1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG |
Rabbit Polyclonal Anti-CHRNA9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA9 antibody: synthetic peptide directed towards the N terminal of human CHRNA9. Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE |
Rabbit Polyclonal Anti-CHRNE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNE antibody: synthetic peptide directed towards the N terminal of human CHRNE. Synthetic peptide located within the following region: GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS |