Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Goat Polyclonal Anti-HTT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
Goat Polyclonal Antibody against PPID / CyP-40
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-TNNI3 (aa117-127) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TNNI3 (aa117-127) Antibody: Peptide with sequence C-KVTKNITEIAD, from the internal region of the protein sequence according to NP_000354.4. |
Goat Polyclonal Anti-TBP /Transcription factor IID (aa39-50) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBP /Transcription factor IID (aa39-50) Antibody: Peptide with sequence C-TPQPIQNTNSLS, from the internal region of the protein sequence according to NP_003185.1; NP_001165556.1. |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit polyclonal antibody to dynactin 1 (dynactin 1 (p150, glued homolog, Drosophila))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1216 and 1278 of DCTN1 (Uniprot ID#Q14203) |
Rabbit anti-TGM2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGM2 |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Rabbit anti-SLC25A4 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC25A4 |
Active filters
Category
- Antibodies
Reactivities
- Rat
Clonalities
- Polyclonal
Pathways
- Huntington's disease
Filter by
Target Symbol
- CREB1 (19)
- TP53 (17)
- HDAC2 (14)
- BAX (13)
- CASP3 (13)
- HDAC1 (13)
- CASP9 (12)
- GRIN1 (11)
- GRIN2B (10)
- SP1 (8)
- SOD2 (7)
- APAF1 (6)
- BDNF (6)
- CYCS (6)
- PPARG (6)
- PPARGC1A (6)
- NDUFS1 (5)
- SOD1 (5)
- TGM2 (5)
- BBC3 (4)
- CASP8 (4)
- COX5B (4)
- DCTN1 (4)
- DCTN2 (4)
- DLG4 (4)
- POLR2G (4)
- TBP (4)
- VDAC2 (4)
- AP2M1 (3)
- COX4I2 (3)
- EP300 (3)
- GRM5 (3)
- NDUFS6 (3)
- SDHA (3)
- SLC25A4 (3)
- AP2A2 (2)
- AP2S1 (2)
- ATP5F1A (2)
- ATP5F1B (2)
- ATP5PF (2)
- CLTA (2)
- CLTC (2)
- COX4I1 (2)
- COX5A (2)
- COX6B1 (2)
- COX6C (2)
- COX7B (2)
- CREB3L2 (2)
- CREBBP (2)
- DNAI2 (2)
- DNAL1 (2)
- NDUFB9 (2)
- NDUFS2 (2)
- NDUFV2 (2)
- NRF1 (2)
- PLCB3 (2)
- POLR2A (2)
- SDHB (2)
- UCP1 (2)
- VDAC1 (2)
- AP2B1 (1)
- ATP5F1C (1)
- ATP5F1D (1)
- ATP5MC3 (1)
- ATP5PB (1)
- ATP5PD (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7B2 (1)
- COX8A (1)
- CREB3L1 (1)
- DCTN4 (1)
- GNAQ (1)
- HAP1 (1)
- HTT (1)
- IFT57 (1)
- ITPR1 (1)
- LCMT2 (1)
- NDUFA1 (1)
- NDUFA4 (1)
- NDUFA5 (1)
- NDUFA7 (1)
- NDUFA9 (1)
- NDUFC2 (1)
- NDUFS4 (1)
- NDUFS5 (1)
- NDUFS7 (1)
- PLCB1 (1)
- PLCB2 (1)
- POLR2B (1)
- POLR2D (1)
- POLR2E (1)
- POLR2H (1)
- POLR2I (1)
- PPID (1)
- SDHD (1)
- SIN3A (1)
- TBPL1 (1)
- TFAM (1)
Applications
Antibody Hosts
Conjugates
Modifications
Families
- Druggable Genome (245)
- Transcription Factors (114)
- Stem cell - Pluripotency (65)
- Transmembrane (61)
- Protease (31)
- ES Cell Differentiation/IPS (27)
- Ion Channels: Glutamate Receptors (21)
- Adult stem cells (19)
- Stem cell relevant signaling - DSL/Notch pathway (13)
- Stem cell relevant signaling - JAK/STAT signaling pathway (8)
- Ion Channels: Other (7)
- Embryonic stem cells (6)
- Induced pluripotent stem cells (6)
- Nuclear Hormone Receptor (6)
- Secreted Protein (6)
- GPCR (3)
- Ion Channels: Transient receptor potential (1)