Germany
Japan
United Kingdom
China
Antibodies
Download
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal LIMK1/2 (Thr508/505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human LIMK1/2 around the phosphorylation site of Threonine 508/505 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Conjugates
- Unconjugated
Pathways
- Regulation of actin cytoskeleton
Filter by
Target Symbol
- MAP2K1 (142)
- EGFR (98)
- BRAF (58)
- MAPK1 (46)
- FGFR2 (39)
- LIMK1 (37)
- PIK3CG (36)
- PDGFRA (35)
- KRAS (34)
- HRAS (27)
- PIK3R5 (27)
- PXN (27)
- PDGFRB (26)
- FGFR1 (25)
- ACTB (23)
- EZR (21)
- PTK2 (21)
- BCAR1 (20)
- MAP2K2 (20)
- PIK3CD (19)
- SHC1 (19)
- BAIAP2 (16)
- MYL7 (16)
- RAF1 (16)
- ARAF (15)
- PIK3CA (14)
- PIKFYVE (14)
- FGF2 (13)
- FN1 (13)
- IQGAP1 (13)
- MAPK3 (13)
- PAK1 (13)
- ITGB3 (12)
- PAK4 (12)
- APC (11)
- FGFR3 (11)
- ITGB1 (11)
- PFN1 (11)
- ROCK2 (11)
- VCL (11)
- NRAS (10)
- PIP4K2A (10)
- ARHGEF4 (9)
- CFL1 (9)
- PIK3R1 (9)
- ACTN1 (8)
- CHRM1 (7)
- FGF13 (7)
- PAK2 (7)
- RHOA (7)
- FGF1 (6)
- LIMK2 (6)
- PPP1CB (6)
- VAV1 (6)
- CSK (5)
- FGF4 (5)
- ITGB4 (5)
- MYL9 (5)
- PDGFB (5)
- PPP1CA (5)
- RAC1 (5)
- ROCK1 (5)
- RRAS (5)
- CDC42 (4)
- FGF12 (4)
- INS (4)
- ITGB6 (4)
- MSN (4)
- PAK3 (4)
- ACTG1 (3)
- ACTN3 (3)
- ARPC1A (3)
- ARPC5 (3)
- BDKRB2 (3)
- CFL2 (3)
- CHRM2 (3)
- CHRM5 (3)
- CRK (3)
- EGF (3)
- F2 (3)
- GSN (3)
- ITGA4 (3)
- ITGAM (3)
- ITGAV (3)
- ITGB5 (3)
- MRAS (3)
- PAK5 (3)
- PDGFA (3)
- PDGFD (3)
- PPP1R12A (3)
- WAS (3)
- ACTN2 (2)
- ACTN4 (2)
- ARHGAP35 (2)
- ARHGEF1 (2)
- ARHGEF7 (2)
- ARPC2 (2)
- CRKL (2)
- DOCK1 (2)
- F2R (2)
Applications
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1305)
- Protein Kinase (674)
- Transmembrane (312)
- ES Cell Differentiation/IPS (305)
- Secreted Protein (211)
- Adult stem cells (111)
- Cancer stem cells (98)
- Stem cell relevant signaling - JAK/STAT signaling pathway (98)
- Stem cell - Pluripotency (56)
- GPCR (19)
- Phosphatase (14)
- Embryonic stem cells (13)
- Induced pluripotent stem cells (10)
- Transcription Factors (10)
- Stem cell relevant signaling - Wnt Signaling pathway (5)
- Protease (3)