Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DLD Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal ASAH1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
HK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK1 |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ACAT1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACAT1 |
OGT Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human OGT |
Rabbit anti-AHCY Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AHCY |
Carrier-free (BSA/glycerol-free) MAOA mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PKM2 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human PKM2 |
Rabbit anti-MAOA Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOA |
Rabbit Polyclonal Anti-PROM1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PROM1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human PROM1. |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit anti-PRDX6 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX6 |
Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
Modifications | Phospho-specific |
Anti-EXT1 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human exostosin glycosyltransferase 1 |
Rabbit anti-TBXAS1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBXAS1 |
Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237) |
Rabbit Monoclonal antibody against AGL
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit polyclonal Cytochrome P450 19A1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1. |
Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
PAH Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PAH |
Rabbit anti-ALDH1A1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH1A1 |
PLCB1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLCB1 |
EXT1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EXT1 |
Rabbit anti-SORD Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SORD |
Rabbit anti-CYP2E1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP2E1 |
Rabbit anti-HSD17B10 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSD17B10 |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
Anti-ADH5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
Modifications | Phospho-specific |
Rabbit anti-AKR1A1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AKR1A1 |
Rabbit anti-SPAM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SPAM1 |
RRM1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RRM1 |
Rabbit anti-PDHA1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDHA1 |
Rabbit anti-ALDH3A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH3A1 |
Rabbit anti-ASNS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ASNS |
Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-GAD67/GAD1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GAD67. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-OAT antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human OAT. |
Rabbit anti-HK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK2 |
MTAP Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MTAP |