Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GFAP Capture mouse monoclonal antibody, Luminex validated, clone OTI4D11
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700041 |
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
GFAP chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Recombinant Human GFAP (expressed in bacteria). After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
| Applications | FC |
| Reactivities | Feline, Human, Rabbit |
| Conjugation | PE |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
USD 220.00
2 Weeks
Active filters
Category
- Antibodies
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- CD4 (232)
- EGFR (207)
- JUN (183)
- GFAP (182)
- ABCB1 (168)
- CTNNB1 (162)
- MKI67 (160)
- GLI1 (151)
- PECAM1 (148)
- VIM (133)
- AKT1 (127)
- PTPRC (120)
- CD44 (105)
- EPCAM (102)
- BCL2 (99)
- L1CAM (96)
- KIT (93)
- TNFRSF8 (89)
- NKX2-1 (88)
- NEFL (78)
- STAT5A (76)
- FGF21 (75)
- NCAM1 (74)
- PROCR (74)
- BSG (69)
- CDH1 (69)
- CD8A (68)
- KRT7 (67)
- CD34 (65)
- PIK3CG (64)
- FCGR2A (63)
- PDGFRA (63)
- TNNI3 (62)
- CSF3 (60)
- CSF2 (59)
- GAPDH (59)
- SDC1 (56)
- MAPK8 (55)
- SMAD1 (55)
- GATA3 (54)
- KDR (53)
- VCAM1 (53)
- NEUROG1 (52)
- TAL1 (52)
- HES1 (50)
- PDGFRB (50)
- CASP3 (49)
- ID3 (48)
- LHX1 (48)
- SERPINA1 (48)
- CD14 (47)
- CDCP1 (47)
- CDX2 (47)
- ENG (46)
- ICAM3 (46)
- CPA1 (45)
- AKT2 (44)
- ENPEP (44)
- CDH2 (43)
- PDX1 (42)
- DVL2 (40)
- CST3 (39)
- HNF4A (39)
- ACTB (38)
- EGF (38)
- MCAM (37)
- SPN (37)
- PTCH1 (36)
- IRF6 (35)
- ITGB3 (35)
- ANPEP (34)
- CD38 (34)
- IGFBP1 (34)
- SIGLEC7 (34)
- SMAD2 (34)
- PROM1 (33)
- CD70 (32)
- MAP2 (32)
- FN1 (31)
- GNL3 (31)
- HGF (31)
- IGF1 (31)
- MAPK9 (31)
- ICAM1 (30)
- SRC (30)
- BCL2L1 (29)
- CSF1 (29)
- IL2RA (29)
- FCGR3A (28)
- NOTCH1 (28)
- HOXD8 (27)
- ITGB1 (27)
- PRKCA (27)
- SOX9 (27)
- BMP6 (25)
- LDLR (25)
- ZFP42 (25)
- KLF5 (24)
- NECTIN1 (24)
- NES (24)
Reactivities
- Human (7392)
- Mouse (3988)
- Rat (3681)
- Dog (386)
- Monkey (370)
- Bovine (61)
- Pig (50)
- Chicken (42)
- Cow (34)
- Canine (29)
- Rabbit (28)
- Primate (22)
- Zebrafish (18)
- Xenopus (17)
- Porcine (14)
- Feline (13)
- Hamster (13)
- Sheep (11)
- Gorilla (10)
- Horse (10)
- Bat (9)
- Drosophila (9)
- Gibbon (8)
- Avian (7)
- Chimpanzee (5)
- Goat (5)
- Guinea Pig (5)
- Mammalian (5)
- Rhesus Monkey (5)
- X. tropicalis (5)
- Yeast (3)
- All Species (2)
- Baboon (2)
- Bacteria (2)
- Fish (2)
- Insect (2)
- Macaque (2)
- Orang-Utan (2)
- Broad (1)
- C. elegans (1)
- Canis (1)
- Equine (1)
- Gerbil (1)
- Invertebrate (1)
- Opossum (1)
- Protozoa (1)
- Quail (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (2332)
- Focal adhesion (1550)
- Colorectal cancer (1332)
- Cell adhesion molecules (CAMs) (1325)
- MAPK signaling pathway (1121)
- Cytokine-cytokine receptor interaction (1064)
- Hematopoietic cell lineage (1064)
- T cell receptor signaling pathway (990)
- Prostate cancer (970)
- ErbB signaling pathway (948)
- Melanoma (876)
- Regulation of actin cytoskeleton (854)
- Endometrial cancer (782)
- Pancreatic cancer (717)
- Glioma (693)
- Wnt signaling pathway (692)
- Leukocyte transendothelial migration (677)
- Neurotrophin signaling pathway (657)
- Adherens junction (656)
- Jak-STAT signaling pathway (634)
- Endocytosis (616)
- Toll-like receptor signaling pathway (593)
- GnRH signaling pathway (566)
- Epithelial cell signaling in Helicobacter pylori infection (555)
- Acute myeloid leukemia (550)
- Non-small cell lung cancer (549)
- Basal cell carcinoma (541)
- Fc gamma R-mediated phagocytosis (524)
- Renal cell carcinoma (520)
- B cell receptor signaling pathway (478)
- Small cell lung cancer (474)
- Tight junction (472)
- Chronic myeloid leukemia (462)
- Gap junction (455)
- Apoptosis (450)
- Fc epsilon RI signaling pathway (449)
- Melanogenesis (425)
- Primary immunodeficiency (423)
- Progesterone-mediated oocyte maturation (412)
- Insulin signaling pathway (391)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (390)
- VEGF signaling pathway (387)
- Pathogenic Escherichia coli infection (382)
- Calcium signaling pathway (381)
- Hedgehog signaling pathway (359)
- TGF-beta signaling pathway (356)
- Chemokine signaling pathway (345)
- Natural killer cell mediated cytotoxicity (341)
- Bladder cancer (337)
- mTOR signaling pathway (326)
- Antigen processing and presentation (322)
- ECM-receptor interaction (316)
- Adipocytokine signaling pathway (293)
- Hypertrophic cardiomyopathy (HCM) (281)
- Thyroid cancer (274)
- Dilated cardiomyopathy (265)
- Dorso-ventral axis formation (258)
- Amyotrophic lateral sclerosis (ALS) (255)
- Maturity onset diabetes of the young (246)
- Type II diabetes mellitus (242)
- Metabolic pathways (208)
- Axon guidance (185)
- ABC transporters (175)
- Notch signaling pathway (171)
- Alzheimer's disease (153)
- Viral myocarditis (145)
- Systemic lupus erythematosus (135)
- Prion diseases (134)
- NOD-like receptor signaling pathway (109)
- p53 signaling pathway (99)
- RIG-I-like receptor signaling pathway (94)
- Renin-angiotensin system (94)
- Phosphatidylinositol signaling system (91)
- Long-term depression (81)
- Cell cycle (80)
- Autoimmune thyroid disease (73)
- Huntington's disease (73)
- Oocyte meiosis (72)
- Complement and coagulation cascades (70)
- Glycolysis / Gluconeogenesis (69)
- Vibrio cholerae infection (65)
- Inositol phosphate metabolism (64)
- Cardiac muscle contraction (62)
- Allograft rejection (57)
- Type I diabetes mellitus (55)
- Long-term potentiation (50)
- Vascular smooth muscle contraction (50)
- Parkinson's disease (49)
- Nicotinate and nicotinamide metabolism (46)
- Graft-versus-host disease (37)
- Glutathione metabolism (34)
- Neuroactive ligand-receptor interaction (32)
- Lysosome (26)
- Amino sugar and nucleotide sugar metabolism (23)
- Fructose and mannose metabolism (23)
- Asthma (20)
- Retinol metabolism (19)
- Regulation of autophagy (18)
- Ubiquitin mediated proteolysis (18)
- Tyrosine metabolism (14)
- Purine metabolism (12)
- Pyrimidine metabolism (12)
- Drug metabolism - cytochrome P450 (10)
- Drug metabolism - other enzymes (10)
- Linoleic acid metabolism (10)
- Metabolism of xenobiotics by cytochrome P450 (10)
- Starch and sucrose metabolism (10)
- Cysteine and methionine metabolism (8)
- Galactose metabolism (8)
- Phenylalanine (8)
- Phenylalanine metabolism (8)
- Ubiquinone and other terpenoid-quinone biosynthesis (8)
- tyrosine and tryptophan biosynthesis (8)
- Oxidative phosphorylation (4)
- PPAR signaling pathway (3)
- Citrate cycle (TCA cycle) (2)
- Pyruvate metabolism (2)
- Primary bile acid biosynthesis (1)