Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GFAP Capture mouse monoclonal antibody, Luminex validated, clone OTI4D11
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700041 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- JUN (176)
- ABCB1 (163)
- GLI1 (150)
- CTNNB1 (144)
- EGFR (143)
- VIM (122)
- AKT1 (112)
- L1CAM (92)
- NKX2-1 (86)
- BCL2 (75)
- STAT5A (73)
- GFAP (72)
- NCAM1 (66)
- PIK3CG (61)
- TNNI3 (55)
- PDGFRA (54)
- NEUROG1 (52)
- SMAD1 (52)
- GATA3 (49)
- GAPDH (48)
- LHX1 (47)
- HES1 (46)
- TAL1 (46)
- CDX2 (45)
- ID3 (45)
- PDX1 (40)
- AKT2 (39)
- CDH2 (39)
- DVL2 (37)
- MAPK8 (37)
- CASP3 (35)
- KDR (34)
- PDGFRB (33)
- PTCH1 (33)
- HNF4A (31)
- IRF6 (30)
- MAPK9 (29)
- HGF (28)
- ACTB (27)
- SMAD2 (26)
- BCL2L1 (25)
- HOXD8 (25)
- MAP2 (24)
- KLF5 (23)
- NOTCH1 (23)
- SOX9 (23)
- BMP6 (22)
- PRKCA (22)
- GLI2 (21)
- YBX1 (21)
- DLX1 (20)
- FN1 (20)
- IGF1 (20)
- GATA4 (19)
- ITGB3 (19)
- SOX2 (19)
- ANGPT1 (18)
- SMAD3 (18)
- SRC (18)
- NEFL (17)
- PTF1A (17)
- SMURF2 (17)
- TGFB1 (17)
- AKT3 (16)
- MAPK3 (16)
- EVX1 (15)
- ITGB1 (15)
- MAPK6 (15)
- SHH (15)
- ID4 (14)
- JAG1 (14)
- ID2 (13)
- FOXA1 (12)
- PAX7 (12)
- TAZ (12)
- TRIM33 (12)
- CD44 (11)
- FOXA2 (11)
- PTCH2 (11)
- RUNX1 (11)
- STAT5B (11)
- ZIC3 (11)
- ACTN1 (10)
- ISL1 (10)
- PAX3 (10)
- PECAM1 (10)
- CDH1 (9)
- GATA1 (9)
- STAT6 (9)
- TUBB3 (9)
- CEBPA (8)
- FLT3 (8)
- GCG (8)
- KIT (8)
- KLF4 (8)
- LEF1 (8)
- NT5E (8)
- ACVR1 (7)
- BDNF (7)
- CD9 (7)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (1640)
- Focal adhesion (1178)
- Colorectal cancer (1090)
- ErbB signaling pathway (757)
- MAPK signaling pathway (752)
- Prostate cancer (734)
- Neurotrophin signaling pathway (568)
- Endometrial cancer (561)
- Wnt signaling pathway (554)
- Melanoma (550)
- Pancreatic cancer (542)
- Glioma (519)
- Toll-like receptor signaling pathway (486)
- Renal cell carcinoma (470)
- T cell receptor signaling pathway (460)
- Basal cell carcinoma (459)
- GnRH signaling pathway (442)
- Regulation of actin cytoskeleton (442)
- Epithelial cell signaling in Helicobacter pylori infection (438)
- Adherens junction (430)
- B cell receptor signaling pathway (421)
- Non-small cell lung cancer (412)
- Chronic myeloid leukemia (399)
- Tight junction (392)
- Cytokine-cytokine receptor interaction (388)
- Acute myeloid leukemia (382)
- Small cell lung cancer (376)
- Jak-STAT signaling pathway (369)
- Apoptosis (365)
- Fc epsilon RI signaling pathway (332)
- Progesterone-mediated oocyte maturation (332)
- Leukocyte transendothelial migration (327)
- VEGF signaling pathway (318)
- Insulin signaling pathway (315)
- Cell adhesion molecules (CAMs) (303)
- Gap junction (303)
- Endocytosis (299)
- Hedgehog signaling pathway (288)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (281)
- Fc gamma R-mediated phagocytosis (273)
- Chemokine signaling pathway (272)
- TGF-beta signaling pathway (272)
- mTOR signaling pathway (266)
- Melanogenesis (264)
- Calcium signaling pathway (253)
- Adipocytokine signaling pathway (241)
- Pathogenic Escherichia coli infection (226)
- Type II diabetes mellitus (187)
- Dorso-ventral axis formation (182)
- Thyroid cancer (180)
- Hypertrophic cardiomyopathy (HCM) (174)
- Bladder cancer (171)
- Dilated cardiomyopathy (169)
- ABC transporters (167)
- Maturity onset diabetes of the young (158)
- Amyotrophic lateral sclerosis (ALS) (152)
- Natural killer cell mediated cytotoxicity (144)
- Axon guidance (136)
- Notch signaling pathway (134)
- Prion diseases (108)
- Alzheimer's disease (104)
- Hematopoietic cell lineage (98)
- ECM-receptor interaction (88)
- Metabolic pathways (84)
- Phosphatidylinositol signaling system (83)
- Viral myocarditis (83)
- NOD-like receptor signaling pathway (82)
- RIG-I-like receptor signaling pathway (72)
- Cell cycle (61)
- Inositol phosphate metabolism (61)
- Long-term depression (58)
- p53 signaling pathway (57)
- Cardiac muscle contraction (55)
- Glycolysis / Gluconeogenesis (51)
- Huntington's disease (49)
- Vibrio cholerae infection (49)
- Long-term potentiation (38)
- Oocyte meiosis (38)
- Vascular smooth muscle contraction (38)
- Parkinson's disease (35)
- Antigen processing and presentation (23)
- Autoimmune thyroid disease (22)
- Type I diabetes mellitus (21)
- Allograft rejection (20)
- Graft-versus-host disease (19)
- Ubiquitin mediated proteolysis (17)
- Renin-angiotensin system (14)
- Neuroactive ligand-receptor interaction (12)
- Primary immunodeficiency (12)
- Systemic lupus erythematosus (12)
- Nicotinate and nicotinamide metabolism (9)
- Retinol metabolism (9)
- Purine metabolism (8)
- Pyrimidine metabolism (8)
- Tyrosine metabolism (7)
- Complement and coagulation cascades (6)
- Cysteine and methionine metabolism (6)
- Lysosome (6)
- Phenylalanine (6)
- Phenylalanine metabolism (6)
- Ubiquinone and other terpenoid-quinone biosynthesis (6)
- tyrosine and tryptophan biosynthesis (6)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Glutathione metabolism (3)
- Linoleic acid metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Oxidative phosphorylation (3)
- PPAR signaling pathway (3)
- Starch and sucrose metabolism (3)
- Amino sugar and nucleotide sugar metabolism (2)
- Citrate cycle (TCA cycle) (2)
- Fructose and mannose metabolism (2)
- Pyruvate metabolism (2)
- Regulation of autophagy (2)
- Asthma (1)
- Galactose metabolism (1)
- Primary bile acid biosynthesis (1)