Rabbit Polyclonal Anti-CTSL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CTSL |
Rabbit Polyclonal Anti-CTSL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CTSL |
Goat Polyclonal Anti-Cathepsin D Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Goat Polyclonal Anti-Cathepsin D Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit polyclonal antibody to CLN2 (tripeptidyl peptidase I)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 224 and 563 of CLN2 (Uniprot ID#O14773) |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
Applications | IHC |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Rabbit Polyclonal Cathepsin V Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal antibody to TPP1 (tripeptidyl peptidase I)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 66 and 324 of TPP1 (Uniprot ID#O14773) |
Rabbit anti-CTSD Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human CTSD |
Rabbit Polyclonal Cathepsin D Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Rabbit anti-CTSH Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CTSH |
Rabbit anti-TPP1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TPP1 |
Rabbit Polyclonal Anti-Cathepsin G Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G |
Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Human, Monkey, Porcine, Rabbit |
Immunogen | KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK. |
Cathepsin E (CTSE) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 260-310 of Human Cathepsin E. |
Cathepsin V (CTSV) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from human CATL2. |
Cathepsin K (CTSK) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 96-126 amino acids from the Central region of Human Cathepsin K |
Rabbit polyclonal Cathepsin D (light chain, Cleaved-Gly65) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cathepsin D AND light chain. |
Rabbit polyclonal Cathepsin D (heavy chain, Cleaved-Leu169) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CATD. |
Rabbit polyclonal anti-Cathepsin D antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CTSD. |
Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CATL1. |
Rabbit polyclonal CATL2 (Cleaved-Leu114) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CATL2. |
Rabbit polyclonal CATZ (Cleaved-Leu62) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CATZ. |
Rabbit Polyclonal Cathepsin B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human NFkB p65 protein (between residues 200-270) [UniProt P07858] |
Cathepsin G (CTSG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human Cathepsin G. |
Cathepsin B (CTSB) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Cathepsin D (CTSD) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Cathepsin D (CTSD) rabbit polyclonal antibody, Aff - Purified
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide surrounding amino acid 140 of Mouse Cathepsins D |
Cathepsin O (CTSO) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 76-106 amino acids from the N-terminal region of human CTSO |
Goat Polyclonal Antibody against CTSK
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KTHRKQYNNKVDE, from the internal region (near N-terminus) of the protein sequence according to NP_000387.1. |
Rabbit polyclonal antibody to Cathepsin S (cathepsin S)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 32 and 265 of Cathepsin S (Uniprot ID#P25774) |
Rabbit Polyclonal Cathepsin E Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminus of mouse Cathepsin E. |
Rabbit polyclonal Cathepsin D (light chain, Cleaved-Gln161) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CTSD. |
Rabbit polyclonal CATG (Cleaved-Ile21) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CATG. |
Rabbit Polyclonal Anti-CTSC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTSC antibody is: synthetic peptide directed towards the N-terminal region of Human CTSC. Synthetic peptide located within the following region: VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD |
Rabbit Polyclonal Anti-CTSS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH |
Rabbit anti Legumain Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal sequence (a portion from 100aa-190aa) of human Legumain protein. This sequence is identical to mouse, human and rat. |
Cathepsin E (CTSE) (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CTSE |
Cathepsin F (CTSF) (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CTSF |
Cathepsin S (CTSS) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CTSS |
Cathepsin D (CTSD) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human |
Immunogen | CTSD antibody was raised against recombinant human cathepsin D protein |
AGA rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide directed towards the middle region of human AGA |
Cathepsin D (CTSD) (C-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 383~412 amino acids from the C-terminal region of human CTSD |
Cathepsin Z (CTSZ) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 29-57 amino acids from the N-terminal region of human CTSZ |
Goat Polyclonal Antibody against CTSF
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CGVNTMASSAVVD, from the C Terminus of the protein sequence according to NP_003784.2. |
Goat Anti-CLN2 / TPP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TPSVIRKRYNLTSQD, from the internal region of the protein sequence according to NP_000382.3. |
Rabbit Polyclonal antibody to Cathepsin D (cathepsin D)
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 72 and 292 of Cathepsin D (Uniprot ID#P07339) |
Rabbit polyclonal Dipeptidyl-peptidase 1 (heavy chain, Cleaved-Arg394) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Dipeptidyl-peptidase 1. |
Rabbit polyclonal anti-Cathepsin L antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 223 of human Cathepsin L |
Rabbit Polyclonal Anti-LGMN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LGMN antibody is: synthetic peptide directed towards the middle region of Human LGMN. Synthetic peptide located within the following region: KMVFYIEACESGSMMNHLPDNINVYATTAANPRESSYACYYDEKRSTYLG |