Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GFAP Capture mouse monoclonal antibody, Luminex validated, clone OTI4D11
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700041 |
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 524.00
In Stock
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- CD4 (219)
- JUN (182)
- ABCB1 (165)
- EGFR (163)
- MKI67 (159)
- GLI1 (151)
- CTNNB1 (146)
- PECAM1 (140)
- VIM (128)
- AKT1 (114)
- EPCAM (100)
- CD44 (99)
- L1CAM (94)
- BCL2 (89)
- PTPRC (89)
- TNFRSF8 (89)
- NKX2-1 (87)
- KIT (80)
- GFAP (79)
- FGF21 (75)
- STAT5A (74)
- PROCR (73)
- NCAM1 (70)
- BSG (66)
- CDH1 (65)
- PIK3CG (64)
- FCGR2A (63)
- KRT7 (62)
- CSF3 (60)
- TNNI3 (59)
- CSF2 (56)
- PDGFRA (56)
- GATA3 (52)
- NEUROG1 (52)
- GAPDH (51)
- SDC1 (51)
- SMAD1 (51)
- TAL1 (51)
- CD34 (49)
- HES1 (49)
- CDX2 (47)
- ID3 (47)
- LHX1 (47)
- VCAM1 (47)
- SERPINA1 (46)
- CPA1 (45)
- CASP3 (44)
- CD14 (43)
- CDCP1 (43)
- ENPEP (42)
- AKT2 (41)
- CDH2 (41)
- ENG (41)
- ICAM3 (41)
- PDX1 (41)
- CST3 (39)
- DVL2 (39)
- KDR (39)
- PDGFRB (39)
- MAPK8 (38)
- HNF4A (36)
- IRF6 (34)
- MCAM (34)
- PTCH1 (34)
- SIGLEC7 (34)
- PROM1 (33)
- SPN (33)
- GNL3 (31)
- HGF (31)
- CD70 (30)
- FN1 (30)
- CD38 (29)
- IGFBP1 (29)
- ACTB (28)
- CSF1 (28)
- MAPK9 (28)
- BCL2L1 (27)
- HOXD8 (27)
- SMAD2 (27)
- CD8A (26)
- EGF (26)
- ITGB3 (26)
- MAP2 (26)
- NOTCH1 (26)
- ANPEP (25)
- LDLR (25)
- ZFP42 (25)
- BMP6 (24)
- ICAM1 (24)
- NECTIN1 (24)
- NES (24)
- SOX9 (24)
- YBX1 (24)
- KLF5 (23)
- MPI (23)
- DLX1 (22)
- GLI2 (22)
- IGF1 (22)
- ITGB1 (22)
- PLAU (22)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (2061)
- Focal adhesion (1323)
- Colorectal cancer (1177)
- Cell adhesion molecules (CAMs) (1138)
- MAPK signaling pathway (971)
- Hematopoietic cell lineage (888)
- Cytokine-cytokine receptor interaction (887)
- T cell receptor signaling pathway (867)
- ErbB signaling pathway (825)
- Prostate cancer (824)
- Melanoma (756)
- Regulation of actin cytoskeleton (698)
- Endometrial cancer (680)
- Wnt signaling pathway (607)
- Neurotrophin signaling pathway (601)
- Pancreatic cancer (601)
- Leukocyte transendothelial migration (590)
- Glioma (581)
- Jak-STAT signaling pathway (577)
- Toll-like receptor signaling pathway (544)
- Adherens junction (543)
- Basal cell carcinoma (498)
- Renal cell carcinoma (492)
- Acute myeloid leukemia (486)
- Endocytosis (486)
- GnRH signaling pathway (475)
- Epithelial cell signaling in Helicobacter pylori infection (473)
- Non-small cell lung cancer (464)
- Fc gamma R-mediated phagocytosis (454)
- B cell receptor signaling pathway (448)
- Small cell lung cancer (431)
- Chronic myeloid leukemia (421)
- Apoptosis (410)
- Tight junction (402)
- Fc epsilon RI signaling pathway (397)
- Melanogenesis (369)
- Gap junction (355)
- Progesterone-mediated oocyte maturation (348)
- Primary immunodeficiency (337)
- Pathogenic Escherichia coli infection (336)
- Insulin signaling pathway (335)
- VEGF signaling pathway (332)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (331)
- Hedgehog signaling pathway (320)
- Calcium signaling pathway (309)
- TGF-beta signaling pathway (303)
- Chemokine signaling pathway (300)
- Natural killer cell mediated cytotoxicity (285)
- mTOR signaling pathway (282)
- ECM-receptor interaction (278)
- Bladder cancer (271)
- Antigen processing and presentation (266)
- Adipocytokine signaling pathway (254)
- Thyroid cancer (247)
- Hypertrophic cardiomyopathy (HCM) (228)
- Dilated cardiomyopathy (214)
- Maturity onset diabetes of the young (210)
- Dorso-ventral axis formation (206)
- Type II diabetes mellitus (201)
- Metabolic pathways (180)
- Amyotrophic lateral sclerosis (ALS) (178)
- ABC transporters (171)
- Notch signaling pathway (160)
- Axon guidance (156)
- Alzheimer's disease (129)
- Prion diseases (119)
- Viral myocarditis (117)
- Systemic lupus erythematosus (115)
- Phosphatidylinositol signaling system (86)
- NOD-like receptor signaling pathway (83)
- Renin-angiotensin system (81)
- p53 signaling pathway (80)
- RIG-I-like receptor signaling pathway (72)
- Complement and coagulation cascades (68)
- Cell cycle (66)
- Huntington's disease (64)
- Inositol phosphate metabolism (64)
- Long-term depression (61)
- Glycolysis / Gluconeogenesis (60)
- Cardiac muscle contraction (59)
- Autoimmune thyroid disease (58)
- Vibrio cholerae infection (50)
- Oocyte meiosis (46)
- Allograft rejection (45)
- Parkinson's disease (44)
- Long-term potentiation (39)
- Nicotinate and nicotinamide metabolism (39)
- Vascular smooth muscle contraction (39)
- Type I diabetes mellitus (38)
- Graft-versus-host disease (31)
- Glutathione metabolism (25)
- Lysosome (24)
- Neuroactive ligand-receptor interaction (24)
- Amino sugar and nucleotide sugar metabolism (23)
- Fructose and mannose metabolism (23)
- Retinol metabolism (17)
- Ubiquitin mediated proteolysis (17)
- Asthma (14)
- Tyrosine metabolism (13)
- Purine metabolism (10)
- Pyrimidine metabolism (10)
- Starch and sucrose metabolism (9)
- Drug metabolism - cytochrome P450 (8)
- Drug metabolism - other enzymes (8)
- Linoleic acid metabolism (8)
- Metabolism of xenobiotics by cytochrome P450 (8)
- Cysteine and methionine metabolism (7)
- Galactose metabolism (7)
- Phenylalanine (7)
- Phenylalanine metabolism (7)
- Regulation of autophagy (7)
- Ubiquinone and other terpenoid-quinone biosynthesis (7)
- tyrosine and tryptophan biosynthesis (7)
- Oxidative phosphorylation (4)
- PPAR signaling pathway (3)
- Citrate cycle (TCA cycle) (2)
- Pyruvate metabolism (2)
- Primary bile acid biosynthesis (1)