Germany
Japan
United Kingdom
China
USD 380.00
2 Weeks
Antibodies
View as table Download
Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit anti-CHRNB1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRNB1 |
Goat Anti-CHRNA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVDRYFTQKEET, from the internal region of the protein sequence according to NP_000736.2. |
Rabbit polyclonal anti-GLRB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLRB. |
CHRNA5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRNA5 |
Rabbit anti-GLRA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human GLRA1 |
USD 585.00
3 Weeks
Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha 4 (extracellular
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)DLVNMHSRVDQLD, corresponding to amino acid residues 190-202 of human nAChRa4. Extracellular, N-terminus. |
Rabbit anti-GABRB2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GABRB2 |
Rabbit anti-CHRNA1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRNA1 |
Rabbit anti-HTR3A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTR3A |
Rabbit anti-GABRR1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GABRR1 |
Rabbit Polyclonal Anti-GABRG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human GABRG2. Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME |
Rabbit Polyclonal Anti-GABRG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRG1 Antibody: A synthesized peptide derived from human GABRG1 |
GABA A Receptor beta 3 (GABRB3) (400-411) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Equine, Hamster, Human, Monkey, Mouse, Rat |
| Immunogen | Synthetic peptide from an internal region of human GABRB3 (NP_000805.1; NP_068712.1) |
Goat Polyclonal Antibody against Serotonin receptor 3A / HTR3A
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GPQDFEKSPRDR, from the internal region of the protein sequence according to NP_998786.1; NP_000860.1. |
Rabbit polyclonal antibody to alpha 2 Glycine Receptor (glycine receptor, alpha 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 216 of Glycine Receptor alpha 2 (Uniprot ID#P23416) |
Rabbit polyclonal anti-5-HT-3A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-3A. |
Rabbit polyclonal anti-GABRA4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GABRA4. |
Rabbit polyclonal anti-CHRNA10 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CHRNA10. |
Rabbit polyclonal CHRNA3 Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CHRNA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 25-52 amino acids from the N-terminal region of human CHRNA3. |
Rabbit polyclonal GABRA2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434 |
| Modifications | Phospho-specific |
Rabbit Polyclonal GABA-RB Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB |
Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-CHRND Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
Rabbit Polyclonal Anti-GABRP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit Polyclonal 5-HT3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563. |
Rabbit Polyclonal Anti-HTR3B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence C-EKTAKAKNDRSK, from the internal region of the protein sequence according to NP_000805.1; NP_068712.1. |
GABA A Receptor gamma 2 (GABRG2) (400-410) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_944494.1; NP_000807.2; NP_944493.2. |
5HT3A receptor (HTR3A) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
USD 440.00
2 Weeks
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Chicken, Equine, Human, Monkey, Porcine |
| Immunogen | Synthetic peptide from an internal region of human CHRNA7 (NP_000737.1) |
CHRNA2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 49-77 amino acids from the N-terminal region of human CHRNA2 |
USD 375.00
5 Days
Rabbit polyclonal anti-CHRNB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CHRNB1. |
Anti-CHRNA10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 360-373 amino acids of human cholinergic receptor, nicotinic, alpha 10 (neuronal) |
USD 410.00
5 Days
Rabbit Polyclonal Anti-HTR3A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG |
Rabbit Polyclonal Anti-CHRNA9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA9 antibody: synthetic peptide directed towards the N terminal of human CHRNA9. Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE |
Active filters
Families
- Ion Channels: Cys-loop Receptors
Filter by
Category
Target Symbol
- GABRA5 (22)
- HTR3A (11)
- CHRNA5 (9)
- GABRB1 (8)
- GABRB3 (7)
- CHRNA1 (6)
- GABRA3 (6)
- GLRA1 (6)
- CHRNA3 (5)
- CHRNA4 (5)
- CHRNB2 (5)
- GABRA1 (5)
- GABRG2 (5)
- CHRNA10 (4)
- CHRNA7 (4)
- CHRND (4)
- GABRA4 (4)
- GABRB2 (4)
- GABRR1 (4)
- CHRNA2 (3)
- CHRNB1 (3)
- GABRA2 (3)
- GABRD (3)
- HTR3B (3)
- HTR3E (3)
- CHRNB3 (2)
- GABRA6 (2)
- GABRE (2)
- GABRG1 (2)
- GABRP (2)
- GLRB (2)
- HTR3C (2)
- CHRNA6 (1)
- CHRNA9 (1)
- CHRNE (1)
- CHRNG (1)
- GABRG3 (1)
- GABRQ (1)
- GABRR2 (1)
- GABRR3 (1)
- GLRA2 (1)
- HTR3D (1)