Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NEK11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11. Synthetic peptide located within the following region: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit Polyclonal Anti-BRD4 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal SYK (Tyr348) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SYK around the phosphorylation site of Tyrosine 348 |
| Modifications | Phospho-specific |
Active filters
Isotypes
- IgG
Families
- Protein Kinase
Filter by
Target Symbol
- AKT1 (51)
- EGFR (51)
- ERBB2 (21)
- KDR (21)
- CHEK1 (20)
- CHUK (19)
- JAK2 (19)
- BRAF (18)
- PRKCD (18)
- RAF1 (17)
- RPS6KB1 (17)
- CHEK2 (16)
- CSF1R (16)
- MAPK14 (16)
- GSK3B (15)
- IGF1R (15)
- IKBKB (15)
- LCK (15)
- MET (15)
- SYK (15)
- CDK1 (14)
- GSK3A (14)
- KIT (14)
- MAPK1 (14)
- PDGFRB (14)
- ROCK2 (14)
- MAPK8 (13)
- PAK1 (13)
- SRC (13)
- ERBB3 (12)
- FGFR1 (12)
- LRRK2 (12)
- MAP2K1 (12)
- MAP3K5 (12)
- MAP3K7 (12)
- PRKAA1 (12)
- PRKCA (12)
- PTK2 (12)
- ZAP70 (12)
- ABL1 (11)
- MAP2K4 (11)
- MAPK3 (11)
- NTRK2 (11)
- CDK2 (10)
- EPHA2 (10)
- LIMK2 (10)
- MAP2K6 (10)
- MTOR (10)
- PRKD1 (10)
- ALK (9)
- CDK5 (9)
- CDK7 (9)
- FGFR2 (9)
- FYN (9)
- GRK5 (9)
- LIMK1 (9)
- PDPK1 (9)
- PRKCB (9)
- PRKDC (9)
- RPS6KA1 (9)
- STK11 (9)
- STK39 (9)
- TGFBR2 (9)
- AURKA (8)
- BCR (8)
- CAMK2A (8)
- EIF2AK2 (8)
- FLT1 (8)
- JAK1 (8)
- MAPKAPK2 (8)
- MERTK (8)
- NTRK1 (8)
- PRKCQ (8)
- RPS6KA5 (8)
- SGK1 (8)
- TGFBR1 (8)
- AKT2 (7)
- BMX (7)
- CAMK1D (7)
- CDK9 (7)
- EPHA3 (7)
- EPHB1 (7)
- FGFR3 (7)
- GRK2 (7)
- INSR (7)
- IRAK3 (7)
- LYN (7)
- MAP2K2 (7)
- MAP3K8 (7)
- MKNK1 (7)
- MST1R (7)
- PAK2 (7)
- PAK5 (7)
- PDGFRA (7)
- PRKACA (7)
- PRKCZ (7)
- PTK2B (7)
- RIPK2 (7)
- TEK (7)
- TNK2 (7)
Reactivities
- Human (2102)
- Mouse (1535)
- Rat (1209)
- Bovine (45)
- Dog (41)
- Chicken (29)
- Pig (24)
- Cow (23)
- Xenopus (10)
- Canis (8)
- Monkey (7)
- Rhesus Monkey (7)
- X. tropicalis (6)
- Canine (5)
- Rabbit (4)
- Chimpanzee (3)
- Zebrafish (3)
- Fish (2)
- Gibbon (2)
- Gorilla (2)
- Invertebrate (2)
- Orang-Utan (2)
- Primate (2)
- Bat (1)
- Drosophila (1)
- Frog (1)
- Hamster (1)
- Horse (1)
- Mammalian (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- MAPK signaling pathway (607)
- Pathways in cancer (548)
- Focal adhesion (465)
- ErbB signaling pathway (439)
- Neurotrophin signaling pathway (388)
- Chemokine signaling pathway (382)
- Prostate cancer (353)
- T cell receptor signaling pathway (322)
- Pancreatic cancer (310)
- Colorectal cancer (304)
- Insulin signaling pathway (302)
- Glioma (297)
- GnRH signaling pathway (292)
- Regulation of actin cytoskeleton (288)
- Fc epsilon RI signaling pathway (283)
- Endocytosis (276)
- Progesterone-mediated oocyte maturation (276)
- Melanoma (269)
- Non-small cell lung cancer (264)
- Toll-like receptor signaling pathway (253)
- Fc gamma R-mediated phagocytosis (248)
- Endometrial cancer (247)
- Acute myeloid leukemia (241)
- Axon guidance (236)
- Chronic myeloid leukemia (235)
- VEGF signaling pathway (231)
- Adherens junction (225)
- Gap junction (223)
- B cell receptor signaling pathway (210)
- Cytokine-cytokine receptor interaction (201)
- mTOR signaling pathway (201)
- Renal cell carcinoma (199)
- Calcium signaling pathway (196)
- Epithelial cell signaling in Helicobacter pylori infection (196)
- Vascular smooth muscle contraction (191)
- Adipocytokine signaling pathway (185)
- Bladder cancer (182)
- Natural killer cell mediated cytotoxicity (181)
- Long-term potentiation (166)
- Oocyte meiosis (166)
- Tight junction (162)
- Wnt signaling pathway (156)
- Apoptosis (154)
- Cell cycle (153)
- Melanogenesis (152)
- Long-term depression (137)
- Small cell lung cancer (128)
- NOD-like receptor signaling pathway (121)
- TGF-beta signaling pathway (121)
- Type II diabetes mellitus (108)
- Jak-STAT signaling pathway (106)
- RIG-I-like receptor signaling pathway (104)
- Leukocyte transendothelial migration (91)
- Dorso-ventral axis formation (88)
- p53 signaling pathway (81)
- Thyroid cancer (73)
- Prion diseases (70)
- Alzheimer's disease (59)
- Hedgehog signaling pathway (52)
- Pathogenic Escherichia coli infection (52)
- Amyotrophic lateral sclerosis (ALS) (49)
- Cytosolic DNA-sensing pathway (45)
- Olfactory transduction (44)
- Vibrio cholerae infection (44)
- Hematopoietic cell lineage (36)
- Primary immunodeficiency (36)
- Regulation of autophagy (29)
- Phosphatidylinositol signaling system (27)
- Viral myocarditis (21)
- Basal cell carcinoma (17)
- Dilated cardiomyopathy (17)
- Hypertrophic cardiomyopathy (HCM) (17)
- Taste transduction (17)
- Parkinson's disease (16)
- PPAR signaling pathway (14)
- Non-homologous end-joining (9)
- Nucleotide excision repair (9)
- Ubiquitin mediated proteolysis (8)
- Circadian rhythm - mammal (7)
- Basal transcription factors (4)
- Purine metabolism (3)