Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-FOXO1 antibody for SISCAPA, clone OTIR3H6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Active filters
Isotypes
- IgG
Pathways
- Pathways in cancer
Filter by
Target Symbol
- AKT1 (51)
- EGFR (51)
- RELA (42)
- TP53 (42)
- JUN (26)
- CTNNB1 (24)
- STAT1 (24)
- BCL2 (23)
- ERBB2 (21)
- STAT3 (21)
- CASP3 (20)
- SMAD3 (20)
- CHUK (19)
- FOXO1 (19)
- HDAC2 (19)
- NFKB1 (19)
- BAX (18)
- BRAF (18)
- NFKBIA (18)
- BAD (17)
- RAF1 (17)
- SMAD2 (17)
- BCL2L1 (16)
- CASP9 (16)
- CSF1R (16)
- NOS3 (16)
- CDH1 (15)
- GSK3B (15)
- HDAC1 (15)
- IGF1R (15)
- IKBKB (15)
- MET (15)
- PTEN (15)
- AR (14)
- CDKN2A (14)
- IKBKG (14)
- KIT (14)
- MAPK1 (14)
- MYC (14)
- NFKB2 (14)
- PDGFRB (14)
- RB1 (14)
- MAPK8 (13)
- STAT5A (13)
- STAT5B (13)
- BIRC5 (12)
- CASP8 (12)
- CCND1 (12)
- CTBP1 (12)
- FGFR1 (12)
- FOS (12)
- HSP90AB1 (12)
- MAP2K1 (12)
- PPARG (12)
- PRKCA (12)
- PTK2 (12)
- RUNX1 (12)
- ABL1 (11)
- CCNE1 (11)
- CDKN1B (11)
- HIF1A (11)
- MAPK3 (11)
- MDM2 (11)
- MMP9 (11)
- NOS2 (11)
- PDGFB (11)
- VEGFA (11)
- BRCA2 (10)
- CDK2 (10)
- FN1 (10)
- JUP (10)
- MITF (10)
- MMP1 (10)
- MMP2 (10)
- MTOR (10)
- PAX8 (10)
- PIAS2 (10)
- PLCG1 (10)
- CCNA1 (9)
- CEBPA (9)
- CTNNA1 (9)
- E2F1 (9)
- FGF4 (9)
- FGFR2 (9)
- MECOM (9)
- PPARD (9)
- PRKCB (9)
- TCF7 (9)
- TGFBR2 (9)
- VEGFB (9)
- APC (8)
- BCR (8)
- CDKN1A (8)
- CYCS (8)
- EGF (8)
- FASLG (8)
- FGF2 (8)
- GSTP1 (8)
- HSP90AA1 (8)
- IGF1 (8)
Reactivities
- Human (2191)
- Mouse (1574)
- Rat (1318)
- Dog (67)
- Bovine (55)
- Pig (43)
- Monkey (39)
- Cow (31)
- Chicken (30)
- Rabbit (18)
- Hamster (14)
- Xenopus (14)
- Gorilla (13)
- Bat (11)
- Canine (11)
- Horse (11)
- Rhesus Monkey (11)
- Gibbon (10)
- Zebrafish (8)
- Chimpanzee (5)
- Feline (5)
- X. tropicalis (4)
- Canis (3)
- Drosophila (3)
- Guinea Pig (2)
- Macaque (2)
- Primate (2)
- Sheep (2)
- Ferret (1)
- Opossum (1)
- Orang-Utan (1)
- Porcine (1)
- Quail (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Families
- Druggable Genome (2134)
- Transcription Factors (717)
- ES Cell Differentiation/IPS (598)
- Protein Kinase (548)
- Transmembrane (505)
- Secreted Protein (354)
- Stem cell - Pluripotency (229)
- Adult stem cells (153)
- Stem cell relevant signaling - JAK/STAT signaling pathway (150)
- Cancer stem cells (131)
- Embryonic stem cells (103)
- Protease (91)
- Stem cell relevant signaling - Wnt Signaling pathway (79)
- Nuclear Hormone Receptor (66)
- Stem cell relevant signaling - DSL/Notch pathway (58)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (56)
- Induced pluripotent stem cells (49)
- GPCR (34)
- Phosphatase (15)