Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Goat Polyclonal Anti-HTT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit Polyclonal Anti-SDHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Active filters
Pathways
- Huntington's disease
Filter by
Target Symbol
- TP53 (255)
- ATP5F1B (53)
- NDUFA7 (51)
- CASP3 (49)
- HDAC1 (49)
- AP2M1 (45)
- NDUFB10 (39)
- COX6A1 (36)
- BAX (35)
- NDUFB9 (34)
- SDHB (33)
- CREB1 (32)
- POLR2H (32)
- TGM2 (30)
- CASP9 (26)
- HDAC2 (26)
- POLR2A (25)
- CLTA (23)
- IFT57 (22)
- UQCRC1 (22)
- NDUFA4L2 (21)
- POLR2J2 (20)
- CASP8 (19)
- GRIN1 (19)
- GRIN2B (18)
- POLR2E (18)
- CYCS (17)
- BBC3 (16)
- NDUFB3 (15)
- PPARG (15)
- SOD2 (15)
- NDUFS2 (14)
- SOD1 (14)
- POLR2J (13)
- APAF1 (12)
- BDNF (12)
- COX6C (12)
- DLG4 (12)
- EP300 (12)
- SP1 (12)
- COX4I1 (11)
- RCOR1 (11)
- TBP (10)
- UQCRFS1 (8)
- ATP5F1C (7)
- CREBBP (7)
- DCTN2 (7)
- DNAL1 (7)
- GRM5 (7)
- NDUFA5 (7)
- NRF1 (7)
- PPARGC1A (7)
- VDAC2 (7)
- AP2B1 (6)
- ATP5PO (6)
- COX6B2 (6)
- DCTN1 (6)
- NDUFA2 (6)
- NDUFS1 (6)
- NDUFV2 (6)
- TFAM (6)
- VDAC1 (6)
- COX6B1 (5)
- NDUFA8 (5)
- NDUFA9 (5)
- NDUFS8 (5)
- POLR2F (5)
- POLR2G (5)
- UCP1 (5)
- AP2A2 (4)
- ATP5F1A (4)
- ATP5F1D (4)
- ATP5PF (4)
- CLTC (4)
- COX5B (4)
- CREB3 (4)
- CREB3L1 (4)
- CREB3L2 (4)
- GPX1 (4)
- HTT (4)
- NDUFA10 (4)
- NDUFA4 (4)
- NDUFS3 (4)
- NDUFS4 (4)
- PLCB3 (4)
- POLR2B (4)
- POLR2I (4)
- PPID (4)
- SDHA (4)
- SLC25A4 (4)
- ATP5PB (3)
- ATP5PD (3)
- COX4I2 (3)
- COX5A (3)
- COX6A2 (3)
- COX7A1 (3)
- COX7A2 (3)
- COX7B (3)
- CREB3L4 (3)
- CYC1 (3)
Reactivities
- Human (1468)
- Mouse (857)
- Rat (801)
- Monkey (184)
- Dog (120)
- Bovine (26)
- Cow (24)
- Pig (22)
- Chimpanzee (11)
- Chicken (10)
- Canine (9)
- Xenopus (9)
- Rabbit (8)
- Rhesus Monkey (8)
- Gerbil (5)
- Primate (5)
- Hamster (4)
- Sheep (4)
- Zebrafish (4)
- X. tropicalis (3)
- Yeast (3)
- Drosophila (2)
- Macaque (2)
- Bat (1)
- Coral (1)
- Equine (1)
- Feline (1)
- Gibbon (1)
- Goat (1)
- Gorilla (1)
- Guinea Pig (1)
- Horse (1)
- Mammalian (1)
- Orang-Utan (1)
- Saccharomyces cerevisiae (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Families
- Druggable Genome (1007)
- Transcription Factors (586)
- Stem cell - Pluripotency (374)
- Transmembrane (235)
- Protease (120)
- ES Cell Differentiation/IPS (73)
- Adult stem cells (61)
- Stem cell relevant signaling - DSL/Notch pathway (49)
- Ion Channels: Glutamate Receptors (37)
- Ion Channels: Other (16)
- Nuclear Hormone Receptor (15)
- Embryonic stem cells (12)
- Induced pluripotent stem cells (12)
- Secreted Protein (12)
- Stem cell relevant signaling - JAK/STAT signaling pathway (12)
- GPCR (7)
- Ion Channels: Transient receptor potential (3)