Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Human IL-1 beta Purified (50 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Human
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- TP53 (238)
- MAP2K1 (225)
- JUN (182)
- EGFR (163)
- MAP2K3 (155)
- GADD45G (133)
- AKT1 (114)
- BRAF (99)
- MAPK13 (96)
- MAPT (83)
- FGF21 (75)
- MAPK1 (69)
- MEF2C (69)
- FGFR2 (64)
- FOS (61)
- HSPA1A (57)
- MAPK7 (57)
- KRAS (56)
- MAPKAPK5 (56)
- PDGFRA (56)
- TNF (53)
- PPP5C (52)
- PPM1B (46)
- HRAS (45)
- CASP3 (44)
- RELA (44)
- RPS6KA2 (44)
- CD14 (43)
- AKT2 (41)
- MYC (41)
- RASGRP3 (40)
- PDGFRB (39)
- IKBKG (38)
- MAPK8 (38)
- IL1A (37)
- MAP2K4 (36)
- FGFR1 (35)
- DDIT3 (34)
- HSPB1 (34)
- MAPK14 (34)
- MAP2K2 (33)
- NFKB1 (33)
- DUSP5 (32)
- CHP1 (28)
- MAPK9 (28)
- HSPA1L (27)
- ATF4 (26)
- EGF (26)
- FGF2 (25)
- DUSP1 (24)
- DUSP10 (24)
- ARRB1 (23)
- ATF2 (23)
- MAP3K8 (23)
- MAPK8IP1 (23)
- HSPA6 (22)
- PRKCA (22)
- NTF3 (21)
- RAF1 (21)
- CHUK (20)
- RASA1 (20)
- TGFB1 (19)
- TGFBR2 (19)
- CDC25B (18)
- IKBKB (18)
- MAPK10 (18)
- PLA2G3 (18)
- AKT3 (17)
- FGFR3 (17)
- MAPK3 (17)
- MAX (17)
- CACNB2 (16)
- IL1B (16)
- MAP3K7 (16)
- NTRK2 (16)
- PTPN7 (16)
- ELK1 (15)
- HSPA8 (15)
- NRAS (15)
- STMN1 (15)
- DUSP4 (14)
- FAS (14)
- GADD45A (14)
- MAP3K5 (14)
- NTF4 (14)
- FGF13 (13)
- MAP3K13 (13)
- PAK1 (13)
- STK3 (13)
- NTRK1 (12)
- PLA2G6 (12)
- BDNF (11)
- CACNB1 (11)
- JUND (11)
- NR4A1 (11)
- PRKCB (11)
- RELB (11)
- RPS6KA1 (11)
- FGF1 (10)
- MAP2K6 (10)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (3897)
- Protein Kinase (1965)
- Transcription Factors (1250)
- ES Cell Differentiation/IPS (971)
- Transmembrane (667)
- Secreted Protein (647)
- Stem cell - Pluripotency (371)
- Adult stem cells (336)
- Phosphatase (228)
- Embryonic stem cells (214)
- Stem cell relevant signaling - JAK/STAT signaling pathway (204)
- Cancer stem cells (163)
- Induced pluripotent stem cells (86)
- Ion Channels: Other (50)
- Stem cell relevant signaling - Wnt Signaling pathway (49)
- Protease (44)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (41)
- Ion Channels: Calcium (17)
- Nuclear Hormone Receptor (11)