Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal IRF7 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7. |
Anti-DDX58 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 909-925 amino acids of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 |
IL12A mouse monoclonal antibody, Azide Free
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Rabbit polyclonal IRF-3 (Ser386) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 386 (A-S-SP-L-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
IFIH1 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFIH1 |
Mouse Monoclonal NAK Antibody (108A429)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine |
| Conjugation | Unconjugated |
TA336453 is a replacement of AM08296PU-N.
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
Active filters
Pathways
- RIG-I-like receptor signaling pathway
Filter by
Target Symbol
- MAPK13 (99)
- TMEM173 (64)
- TNF (60)
- MAPK8 (55)
- RELA (54)
- IKBKG (41)
- MAPK14 (41)
- IRF3 (40)
- NFKB1 (36)
- RIPK1 (35)
- IFIH1 (31)
- MAPK9 (31)
- IL12A (30)
- NFKBIA (30)
- IKBKE (28)
- CHUK (26)
- CXCL8 (26)
- DDX58 (24)
- MAVS (24)
- IL12B (21)
- IKBKB (20)
- CASP8 (19)
- MAPK10 (19)
- MAP3K7 (17)
- PIN1 (15)
- NFKBIB (13)
- FADD (11)
- ATG5 (10)
- IFNB1 (10)
- NLRX1 (10)
- TANK (10)
- TRAF6 (10)
- CXCL10 (9)
- MAPK12 (9)
- TRAF2 (9)
- CASP10 (8)
- ISG15 (8)
- TRIM25 (8)
- DDX3X (7)
- IFNA2 (7)
- MAPK11 (7)
- TRAF3 (7)
- DHX58 (6)
- IFNA6 (6)
- IRF7 (6)
- TBK1 (6)
- TRADD (6)
- ATG12 (5)
- AZI2 (4)
- MAP3K1 (4)
- CYLD (3)
- DDX3Y (3)
- TBKBP1 (3)
- TKFC (3)
- IFNA16 (2)
- IFNA4 (2)
- RNF125 (2)
- DDX3 (1)
- IFNA1 (1)
- IFNA13 (1)
- IFNA17 (1)
- IFNA5 (1)
- IFNA7 (1)
- IFNA8 (1)
- IFNE (1)
- IFNK (1)
- OTUD5 (1)