Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Anti-KEAP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human kelch-like ECH-associated protein 1 |
Rabbit Polyclonal Anti-PML Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PML antibody: synthetic peptide directed towards the middle region of human PML. Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ |
Rabbit Polyclonal Anti-TRIM32 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY |
Rabbit polyclonal anti-APC10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Rabbit polyclonal Parkin Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin. |
CBLB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CBLB |
Rabbit Polyclonal anti-Elongin C Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant full-length |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC |
Rabbit Polyclonal Anti-BSDC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal cIAP2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to UBE2G2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 165 of UBE2G2 (Uniprot ID#P60604) |
Rabbit Polyclonal Anti-UBE2O Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2O antibody: synthetic peptide directed towards the middle region of human UBE2O. Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL |
Rabbit Polyclonal XIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP. |
Goat Anti-RNF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DACLRCQAENKQE, from the internal region of the protein sequence according to NP_055060.1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Ubiquitin mediated proteolysis
Filter by
Target Symbol
- MDM2 (121)
- UBE2E3 (95)
- SOCS3 (59)
- BRCA1 (56)
- FBXW7 (53)
- UBE2G2 (51)
- UBE2J1 (46)
- BIRC3 (44)
- UBE2D2 (44)
- SAE1 (37)
- MGRN1 (36)
- ANAPC11 (33)
- BTRC (32)
- ANAPC2 (31)
- ERCC8 (30)
- UBE2S (30)
- UBOX5 (30)
- NEDD4 (29)
- KEAP1 (25)
- PIAS2 (22)
- UBA3 (21)
- CUL4B (20)
- SMURF2 (18)
- CBLC (16)
- AIRE (15)
- SOCS1 (14)
- TTK (14)
- UBE3B (12)
- VHL (12)
- TRAF6 (10)
- CBL (9)
- CDC16 (9)
- PIAS1 (9)
- PML (9)
- UBA2 (9)
- ANAPC1 (8)
- CDC27 (8)
- PRKN (8)
- SIAH1 (8)
- UBA7 (8)
- UBE2D1 (8)
- UBE2K (8)
- CUL1 (7)
- CUL2 (7)
- CUL3 (7)
- DDB1 (7)
- DDB2 (7)
- STUB1 (7)
- UBE2B (7)
- UBE2L3 (7)
- XIAP (7)
- ANAPC5 (6)
- BIRC2 (6)
- CDC20 (6)
- CDC23 (6)
- PIAS3 (6)
- SKP2 (6)
- SYVN1 (6)
- TRIM32 (6)
- UBE2C (6)
- UBE2D4 (6)
- UBE2I (6)
- UBE2M (6)
- UBR5 (6)
- ANAPC10 (5)
- BIRC6 (5)
- CUL4A (5)
- CUL5 (5)
- ITCH (5)
- SKP1 (5)
- SMURF1 (5)
- UBA1 (5)
- ANAPC4 (4)
- CDC34 (4)
- CUL7 (4)
- ELOC (4)
- FANCL (4)
- FBXO4 (4)
- FBXW11 (4)
- MAP3K1 (4)
- MID1 (4)
- PIAS4 (4)
- UBE2E1 (4)
- UBE2N (4)
- WWP2 (4)
- ANAPC13 (3)
- ANAPC7 (3)
- CDC26 (3)
- COP1 (3)
- FBXO2 (3)
- FBXW8 (3)
- HERC4 (3)
- PRPF19 (3)
- UBA6 (3)
- UBE2L6 (3)
- CIAP2 (2)
- ELOB (2)
- FZR1 (2)
- KLHL9 (2)
- NEDD4L (2)