CD4 mouse monoclonal antibody, clone B-A1, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
Rabbit Polyclonal CD4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit anti-BDNF Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BDNF |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
Applications | FC, IHC |
Reactivities | Guinea Pig |
Rabbit Polyclonal Anti-WNT5A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
CD34 mouse monoclonal antibody, clone QBEnd-10, Azide Free
Applications | FC, FN, IHC, IP, WB |
Reactivities | Human, Primate |
CD4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 391-440 of Human CD4. |
Rabbit Polyclonal Antibody against CD14 (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
CD14 (71-84) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human CD14 (NP_000582.1) |
Rabbit Polyclonal Antibody against CD14 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14. |
Rabbit Polyclonal Anti-WNT7B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
CD4 mouse monoclonal antibody, clone B-A1, Purified
Applications | FC, IHC |
Reactivities | Human |
CD14 mouse monoclonal antibody, clone B-A8, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit. |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit polyclonal anti-WNT1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit Polyclonal Wnt-5a Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy7 |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
Applications | IHC, IP |
Reactivities | Human, Rat |
CD4 mouse monoclonal antibody, clone CA-4, Purified
Applications | IF, IHC |
Reactivities | Human |
CD34 Class III mouse monoclonal antibody, clone B-F23, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD34 Class III mouse monoclonal antibody, clone B-F23, Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Purified
Applications | FC, IHC |
Reactivities | Human |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone MCD8, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
Mouse Monoclonal CD8 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
CD8A mouse monoclonal antibody, clone 144B, Supernatant
Applications | IHC |
Reactivities | Human |
CD8A rabbit monoclonal antibody, clone SP16, Supernatant
Applications | IHC |
Reactivities | Human |
WNT6 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit |
Conjugation | Unconjugated |
Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |