Germany
Japan
United Kingdom
China
Research Areas
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
IL6 mouse monoclonal antibody, clone B-E8, Azide Free
| Applications | ELISA, FC, FN |
| Reactivities | Human |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT |
Periostin (POSTN) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Recombinant Human OSF-2 Source of Antigen: E. coli. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
| Applications | FC, IHC |
| Reactivities | Guinea Pig |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
CD130 (IL6ST) mouse monoclonal antibody, clone B-K5, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P8, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-S12, Azide Free
| Applications | FC, FN, IP, WB |
| Reactivities | Human |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Rat |
| Immunogen | This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR. |
IL4 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Goat Polyclonal Antibody against WNT4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit Polyclonal antibody to IL1ra antagonist (interleukin 1 receptor antagonist)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 177 of IL1ra antagonist (Uniprot ID#P18510) |
Active filters
Category
-
- Antibodies
-
Families
- Secreted Protein
Filter by
Target Symbol
- IL6 (139)
- IL1RL1 (105)
- LGALS3 (79)
- WNT3 (47)
- IL1RN (40)
- CRP (38)
- CD8A (35)
- FCER2 (35)
- CSF3 (24)
- TNF (22)
- POSTN (16)
- IL6ST (14)
- IL36G (12)
- IL2 (11)
- IL12B (10)
- WNT1 (10)
- IL1A (8)
- IL1B (8)
- WNT3A (8)
- WNT5B (8)
- FCGR3A (7)
- WNT2B (7)
- WNT4 (7)
- CALR (6)
- WNT10A (6)
- WNT6 (6)
- WNT9A (6)
- CXCL8 (5)
- IL10 (5)
- IL36A (5)
- WNT16 (5)
- WNT2 (5)
- CD163 (4)
- IL4 (4)
- WNT5A (4)
- WNT11 (3)
- ACE2 (2)
- ENTPD6 (2)
- FRZB (2)
- IL36RN (2)
- TNFRSF1B (2)
- WNT7A (2)
- BDNF (1)
- CCL3 (1)
- IL18 (1)
- IL1F10 (1)
- IL1RAP (1)
- IL33 (1)
- IL36B (1)
- IL37 (1)
- MASP2 (1)
- WNT7B (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Assay Types
Assay Platforms
Pathways
- Hematopoietic cell lineage (275)
- Pathways in cancer (269)
- Cytokine-cytokine receptor interaction (255)
- Jak-STAT signaling pathway (207)
- Graft-versus-host disease (188)
- Toll-like receptor signaling pathway (185)
- NOD-like receptor signaling pathway (175)
- Hypertrophic cardiomyopathy (HCM) (161)
- Prion diseases (155)
- Cytosolic DNA-sensing pathway (149)
- Basal cell carcinoma (125)
- Hedgehog signaling pathway (125)
- Melanogenesis (125)
- Wnt signaling pathway (125)
- T cell receptor signaling pathway (77)
- Type I diabetes mellitus (59)
- Allograft rejection (52)
- Antigen processing and presentation (41)
- Apoptosis (39)
- MAPK signaling pathway (39)
- RIG-I-like receptor signaling pathway (37)
- Cell adhesion molecules (CAMs) (35)
- Primary immunodeficiency (35)
- Systemic lupus erythematosus (34)
- Asthma (31)
- Alzheimer's disease (30)
- Natural killer cell mediated cytotoxicity (29)
- Fc epsilon RI signaling pathway (26)
- Adipocytokine signaling pathway (24)
- Amyotrophic lateral sclerosis (ALS) (24)
- Dilated cardiomyopathy (22)
- TGF-beta signaling pathway (22)
- Type II diabetes mellitus (22)
- Autoimmune thyroid disease (20)
- Fc gamma R-mediated phagocytosis (7)
- Chemokine signaling pathway (6)
- Bladder cancer (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Renin-angiotensin system (2)
- Complement and coagulation cascades (1)
- Huntington's disease (1)
- Neurotrophin signaling pathway (1)