Products

View as table Download

Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696)

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA

Rabbit Monoclonal antibody against DHFR

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal ALPL Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ALPL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the Central region of human ALPL.

Rabbit Polyclonal antibody to SPR (sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase))

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 65 and 261 of SPR (Uniprot ID#P35270)

Rabbit anti-DHFR Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DHFR

Rabbit Polyclonal antibody to PTS (6-pyruvoyltetrahydropterin synthase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 145 of PTS (Uniprot ID#Q03393)

Rabbit polyclonal antibody to Alkaline phosphatase(placental ) (alkaline phosphatase, placental (Regan isozyme))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 163 and 387 of Placental Alkaline Phosphatase (Uniprot ID#P05187)

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1

Anti-DHFR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit anti-QDPR Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human QDPR

GGH (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 236-264 amino acids from the C-terminal region of human GGH

GGH (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 14-42 amino acids from the N-terminal region of human GGH

Rabbit polyclonal antibody to alkaline phosphatase(intestinal) (alkaline phosphatase, intestinal)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 3 and 206 of Alkaline phosphatase (intestinal) (Uniprot ID#P09923)

Rabbit polyclonal anti-ALPL antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALPL.
Modifications Phospho-specific

Rabbit polyclonal anti-GGH antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GGH.

Alkaline Phosphatase (ALPL) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of Human ALPL (21-35)

Rabbit polyclonal antibody to alkaline phosphatase (liver/bone/kidney) (alkaline phosphatase, liver/bone/kidney)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 359 of Alkaline Phosphatase (Tissue Non-Specific) (Uniprot ID#P05186)

Rabbit polyclonal Alkaline Phosphatase (ALPI) Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Alkaline Phosphatase (ALPI) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-304 amino acids from the Central region of human Alkaline Phosphatase (ALPI).

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT

Folylpolyglutamate synthase (FPGS) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human FPGS

GGH rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Alkaline Phosphatase (ALPP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 55-83 amino acids from the N-terminal region of human ALPP

SPR (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 232-261aa) of human Sepiapterin reductase / SPR.

Rabbit polyclonal Alkaline Phosphatase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Alkaline Phosphatase [Human Intestine]

Rabbit polyclonal Alkaline Phosphatase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Alkaline Phosphatase [Human Intestine]

Rabbit Polyclonal anti-ALPPL2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2. Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT

Rabbit Polyclonal anti-ALPPL2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the middle region of human ALPPL2. Synthetic peptide located within the following region: SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody is: synthetic peptide directed towards the N-terminal region of Human GCH1. Synthetic peptide located within the following region: PPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQR

Rabbit anti PLAP Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Anti-ALPL Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-329amino acids of Human Alkaline phosphatase

Anti-ALPL Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-329 amino acids of Human Alkaline phosphatase

Anti-ALPPL2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of human alkaline phosphatase, placental-like 2

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1

Rabbit Polyclonal Anti-ALPI Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPI

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPP

Rabbit Polyclonal Anti-SPR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPR

GGH Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated