Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700026 |
Mouse Monoclonal iNOS Antibody (4E5)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
TNFRSF1A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone TBP
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700021 |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Rabbit Polyclonal eNOS Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal eNOS Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
BID (1-195) mouse monoclonal antibody, clone 4D3, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
BID (1-195) mouse monoclonal antibody, clone 4D3, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
SAPK4 (MAPK13) mouse monoclonal antibody, clone 1E11, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
SAPK4 (MAPK13) mouse monoclonal antibody, clone 2B2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
SAPK4 (MAPK13) mouse monoclonal antibody, clone 2D8, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Rat |
ASK1 (MAP3K5) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | MAP3K5 antibody was raised against synthetic peptide - KLH conjugated |
Caspase 9 (CASP9) (299-318) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Akirin1 antibody was raised against peptide corresponding to aa 299-318 of the human Caspase 9. |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
MEK3 (MAP2K3) (1-100) mouse monoclonal antibody, clone 1D10, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Caspase 3 (CASP3) (p17) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Catalase (CAT) (498-511) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Canine, Equine, Hamster, Human, Monkey, Mouse |
Immunogen | Synthetic peptide from an internal region of human CAT |
Caspase 1 (CASP1) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant rat HO-1 (Hsp32) lacking the membrane spanning region |
Caspase 1 (CASP1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | HT-29 colon carcinoma cell line. |
ASK1 (MAP3K5) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | MAP3K5 antibody was raised against synthetic peptide - KLH conjugated |
Glutathione Peroxidase 1 (GPX1) (130-142) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Equine, Human, Monkey |
Immunogen | GPX1 antibody was raised against synthetic peptide from an internal region of human GPX1 |
GRIA1 (264-277) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_000818.2; NP_001107655.1. |
Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal Bcl2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
eNOS (NOS3) mouse monoclonal antibody, clone 6H2, Ascites
Applications | ELISA, IHC |
Reactivities | Human |
TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified
Applications | ELISA, FN |
Reactivities | Human |
Catalase (CAT) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
Applications | ELISA |
Reactivities | Human |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
Applications | ELISA |
Reactivities | Human |
TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Biotinylated Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Biotinylated Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI11F8
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI5C8
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI2D1
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI1E7
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI3F8
Carrier-free (BSA/glycerol-free) NEFL mouse monoclonal antibody, clone OTI3E4