Products

View as table Download

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700026

Mouse Monoclonal iNOS Antibody (4E5)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
TA336918 is a replacement of AM06772PU-N.

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I

Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I

TNFRSF1A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone TBP

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700021

Rabbit Polyclonal eNOS Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal eNOS Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

BID (1-195) mouse monoclonal antibody, clone 4D3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

BID (1-195) mouse monoclonal antibody, clone 4D3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Mouse

BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human, Mouse

SAPK4 (MAPK13) mouse monoclonal antibody, clone 1E11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

SAPK4 (MAPK13) mouse monoclonal antibody, clone 2B2, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

SAPK4 (MAPK13) mouse monoclonal antibody, clone 2D8, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

ASK1 (MAP3K5) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen MAP3K5 antibody was raised against synthetic peptide - KLH conjugated

Caspase 9 (CASP9) (299-318) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Akirin1 antibody was raised against peptide corresponding to aa 299-318 of the human Caspase 9.

TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified

Applications ELISA, FN, WB
Reactivities Human

Caspase 3 (CASP3) (p17) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Catalase (CAT) (498-511) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Mouse
Immunogen Synthetic peptide from an internal region of human CAT

Caspase 1 (CASP1) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Recombinant rat HO-1 (Hsp32) lacking the membrane spanning region

Caspase 1 (CASP1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen HT-29 colon carcinoma cell line.

ASK1 (MAP3K5) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen MAP3K5 antibody was raised against synthetic peptide - KLH conjugated

Glutathione Peroxidase 1 (GPX1) (130-142) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Equine, Human, Monkey
Immunogen GPX1 antibody was raised against synthetic peptide from an internal region of human GPX1

GRIA1 (264-277) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_000818.2; NP_001107655.1.

Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Rabbit Polyclonal Bcl2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

eNOS (NOS3) mouse monoclonal antibody, clone 6H2, Ascites

Applications ELISA, IHC
Reactivities Human

TNF alpha (TNF) mouse monoclonal antibody, clone 2C8, Aff - Purified

Applications ELISA, FN
Reactivities Human

Catalase (CAT) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin

TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP

Applications ELISA
Reactivities Human
Conjugation HRP

TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified

Applications ELISA
Reactivities Human

TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified

Applications ELISA
Reactivities Human

TNFRSF1B mouse monoclonal antibody, clone KT30, Aff - Purified

Applications ELISA
Reactivities Human

Biotinylated Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α

Biotinylated Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α