Germany
Japan
United Kingdom
China
Products
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal Anti-TARDBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the C terminal of human TARDBP. Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG |
Rabbit Polyclonal Anti-HMGB2 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS |
Rabbit Polyclonal Anti-HOXA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5. Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG |
Rabbit Polyclonal Anti-HOXC8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the N terminal of human HOXC8. Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the N terminal of human HNRPD. Synthetic peptide located within the following region: AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTK |
Rabbit Polyclonal Anti-ILF3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ILF3 antibody: synthetic peptide directed towards the N terminal of human ILF3. Synthetic peptide located within the following region: ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR |
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Anti-KEAP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human kelch-like ECH-associated protein 1 |
Rabbit Polyclonal Anti-ZBTB25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB25 antibody: synthetic peptide directed towards the middle region of human ZBTB25. Synthetic peptide located within the following region: GNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILV |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit Polyclonal Anti-TFEB Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP |
Rabbit Polyclonal Anti-PHF21A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF21A antibody: synthetic peptide directed towards the N terminal of human PHF21A. Synthetic peptide located within the following region: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK |
USD 475.00
5 Days
Rabbit Polyclonal Anti-DEAF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the N terminal of human DEAF1. Synthetic peptide located within the following region: EEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPD |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Active filters
Category
-
- Antibodies
-
Families
- Transcription Factors
Filter by
Target Symbol
- TP53 (255)
- JUN (183)
- PGR (172)
- CTNNB1 (162)
- MAP2K3 (158)
- GLI1 (151)
- MDM2 (121)
- NKX3-1 (115)
- CD80 (103)
- NKX2-1 (90)
- MDM4 (81)
- STAT5A (76)
- BHLHE41 (74)
- UBA52 (73)
- ESR1 (72)
- MEF2C (71)
- SQSTM1 (71)
- STAT4 (71)
- CNOT4 (70)
- SNAI2 (69)
- NR3C1 (68)
- CBX8 (67)
- HDAC10 (66)
- FOXO1 (65)
- SLA2 (65)
- FOS (64)
- PSMC3 (63)
- CD86 (62)
- TLE1 (62)
- MYC (61)
- TNF (60)
- MCM2 (59)
- RB1 (59)
- ERG (58)
- FOSB (57)
- TCF12 (57)
- BCL6 (56)
- BRCA1 (56)
- NAB1 (56)
- ZEB1 (56)
- ESRRA (55)
- HDAC6 (55)
- NR2E3 (55)
- SMAD1 (55)
- GATA3 (54)
- PRRX1 (54)
- RELA (54)
- FOXI1 (53)
- FOXO4 (53)
- HDAC4 (53)
- HDAC9 (53)
- ELF4 (52)
- ELL (52)
- MEOX1 (52)
- NEUROG1 (52)
- NR2C2 (52)
- PPP5C (52)
- STAT1 (52)
- TAL1 (52)
- ZNF69 (51)
- HES1 (50)
- RARA (50)
- AR (49)
- CLOCK (49)
- FOXP3 (49)
- HDAC1 (49)
- SIRT5 (49)
- SKIL (49)
- HSF2 (48)
- ID3 (48)
- LHX1 (48)
- PARN (48)
- ZSCAN18 (48)
- CDX2 (47)
- ELF3 (47)
- HOXC10 (47)
- LHX2 (47)
- NAB2 (47)
- NR2C1 (47)
- RFXANK (47)
- RYBP (47)
- ZFP37 (47)
- ATF1 (46)
- ELK3 (46)
- MRTFA (46)
- NR1I3 (46)
- TET3 (46)
- BTG2 (45)
- PPARA (45)
- THRA (44)
- TP53BP1 (44)
- TSC22D1 (44)
- GCM1 (43)
- KLF2 (43)
- MED15 (43)
- TCEAL1 (43)
- UBP1 (43)
- NFKBIE (42)
- NR4A3 (42)
- PDX1 (42)
Reactivities
- Human (16617)
- Mouse (10043)
- Rat (8710)
- Dog (727)
- Monkey (619)
- Bovine (136)
- Cow (131)
- Pig (122)
- Chicken (48)
- Primate (38)
- Xenopus (33)
- Zebrafish (27)
- Canine (26)
- Hamster (23)
- Rabbit (22)
- Rhesus Monkey (17)
- Chimpanzee (14)
- Horse (13)
- Sheep (11)
- Porcine (10)
- X. tropicalis (10)
- Feline (8)
- Guinea Pig (6)
- Bat (5)
- Drosophila (5)
- Gibbon (5)
- Gorilla (5)
- Macaque (4)
- Equine (3)
- Ferret (3)
- Fish (3)
- Goat (2)
- Yeast (2)
- C. elegans (1)
- Canis (1)
- Gerbil (1)
- Mammalian (1)
- Opossum (1)
- Pufferfish (1)
- Saccharomyces cerevisiae (1)
- Turkey (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (2345)
- MAPK signaling pathway (1360)
- Prostate cancer (1129)
- Cell cycle (978)
- Chronic myeloid leukemia (962)
- Wnt signaling pathway (945)
- Toll-like receptor signaling pathway (914)
- Colorectal cancer (842)
- Neurotrophin signaling pathway (771)
- Pancreatic cancer (675)
- Small cell lung cancer (648)
- Basal cell carcinoma (601)
- T cell receptor signaling pathway (592)
- Huntington's disease (586)
- Thyroid cancer (579)
- Endometrial cancer (554)
- Bladder cancer (531)
- TGF-beta signaling pathway (526)
- p53 signaling pathway (521)
- Apoptosis (520)
- B cell receptor signaling pathway (512)
- Amyotrophic lateral sclerosis (ALS) (500)
- Acute myeloid leukemia (492)
- Melanoma (482)
- Glioma (459)
- ErbB signaling pathway (410)
- Jak-STAT signaling pathway (404)
- Non-small cell lung cancer (400)
- Adipocytokine signaling pathway (398)
- GnRH signaling pathway (385)
- Focal adhesion (379)
- Ubiquitin mediated proteolysis (349)
- Renal cell carcinoma (344)
- Adherens junction (341)
- Epithelial cell signaling in Helicobacter pylori infection (334)
- Chemokine signaling pathway (330)
- Oocyte meiosis (287)
- RIG-I-like receptor signaling pathway (278)
- Maturity onset diabetes of the young (274)
- Systemic lupus erythematosus (269)
- Melanogenesis (267)
- Cytosolic DNA-sensing pathway (244)
- Allograft rejection (243)
- Graft-versus-host disease (243)
- Type I diabetes mellitus (243)
- Metabolic pathways (237)
- Fc epsilon RI signaling pathway (228)
- Tight junction (227)
- NOD-like receptor signaling pathway (224)
- Viral myocarditis (215)
- Circadian rhythm - mammal (202)
- Pathogenic Escherichia coli infection (191)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (189)
- Leukocyte transendothelial migration (185)
- Notch signaling pathway (185)
- Autoimmune thyroid disease (183)
- Cell adhesion molecules (CAMs) (183)
- Endocytosis (178)
- Basal transcription factors (177)
- Insulin signaling pathway (175)
- Progesterone-mediated oocyte maturation (172)
- RNA degradation (172)
- Purine metabolism (165)
- Pyrimidine metabolism (165)
- Hedgehog signaling pathway (157)
- RNA polymerase (155)
- Antigen processing and presentation (152)
- Neuroactive ligand-receptor interaction (134)
- Type II diabetes mellitus (122)
- PPAR signaling pathway (121)
- Natural killer cell mediated cytotoxicity (118)
- Alzheimer's disease (115)
- Nucleotide excision repair (114)
- DNA replication (105)
- Cytokine-cytokine receptor interaction (97)
- Primary immunodeficiency (93)
- Dilated cardiomyopathy (82)
- Hypertrophic cardiomyopathy (HCM) (82)
- Ribosome (77)
- Axon guidance (69)
- Base excision repair (65)
- Proteasome (63)
- mTOR signaling pathway (61)
- Asthma (60)
- Hematopoietic cell lineage (60)
- Dorso-ventral axis formation (53)
- Long-term potentiation (50)
- VEGF signaling pathway (48)
- Long-term depression (36)
- Lysine degradation (27)
- Spliceosome (26)
- Regulation of actin cytoskeleton (23)
- Fc gamma R-mediated phagocytosis (20)
- Calcium signaling pathway (19)
- Non-homologous end-joining (17)
- Prion diseases (15)
- Cysteine and methionine metabolism (14)
- Glycolysis / Gluconeogenesis (13)
- Homologous recombination (12)
- Vascular smooth muscle contraction (11)
- Valine (6)
- Biosynthesis of unsaturated fatty acids (5)
- leucine and isoleucine degradation (5)
- Glycerolipid metabolism (4)
- Glycine (4)
- Glyoxylate and dicarboxylate metabolism (4)
- serine and threonine metabolism (4)
- Ether lipid metabolism (3)
- Mismatch repair (3)
- SNARE interactions in vesicular transport (2)
- Aminoacyl-tRNA biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- leucine and isoleucine biosynthesis (1)