Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
TGF beta Receptor I (TGFBR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human TGFβ RI. |
SLUG (SNAI2) (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SLUG. |
EIF3K (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 175-204 amino acids from the C-terminal region of human EIF3K |
Procollagen Type III rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Human, Porcine |
| Immunogen | Purified Human Procollagen type III C-terminal and N-terminal PIIICP separated. |
OVAL rabbit polyclonal antibody, Biotin, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Chicken |
| Conjugation | Biotin |
| Immunogen | Native Ovalbumin from hen egg white |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal TET1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human TET1 protein (between residues 1700 to 1800) [UniProt Q8NFU7] |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Melatonin Receptor 1B (MTNR1B) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids N-terminus of Human MEL-1B-R. |
Lyve1 rabbit polyclonal antibody, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | Highly pure recombinant Mouse soluble LYVE-1 (Ala24-Gly228) produced in insect cells (Cat.-No DA3524). This recombinant soluble LYVE-1 consists of amino acid 24 (Ala) to 228 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type IV purified from Human and Bovine placenta. |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit polyclonal HAPLN1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HAPLN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-38 amino acids from the N-terminal region of human HAPLN1. |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
USD 380.00
2 Weeks
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Active filters
Antibody Hosts
- Rabbit
Citations
- Yes
Filter by
Target Symbol
- COL1A1 (5)
- KDR (5)
- CXCL12 (4)
- GAPDH (4)
- ACTB (3)
- BAX (3)
- CD274 (3)
- MYL2 (3)
- PPARGC1A (3)
- RAC1 (3)
- ABCD3 (2)
- ABCG2 (2)
- ADH5 (2)
- ANGPT2 (2)
- AOX1 (2)
- BAG3 (2)
- BDNF (2)
- BRAF (2)
- CALCRL (2)
- CAMK2A (2)
- CASP9 (2)
- CCNA2 (2)
- CCNB1 (2)
- CCR6 (2)
- CDH2 (2)
- CHMP4C (2)
- COL4A1 (2)
- CTNNB1 (2)
- DDX58 (2)
- DRD2 (2)
- ELOVL5 (2)
- FBXO17 (2)
- FSHR (2)
- G6PC (2)
- GAD1 (2)
- GPER1 (2)
- GRIN2B (2)
- H3C1 (2)
- HIF1A (2)
- HMMR (2)
- HMOX1 (2)
- IPMK (2)
- IRS1 (2)
- MAP1LC3B (2)
- MAP3K5 (2)
- MAPK8 (2)
- MITF (2)
- MMP2 (2)
- MTNR1A (2)
- NFKB1 (2)
- NOS3 (2)
- NOTCH2 (2)
- OPN3 (2)
- PECAM1 (2)
- PFKFB2 (2)
- PGF (2)
- PIK3R1 (2)
- PKM (2)
- POU5F1 (2)
- RELA (2)
- ROR2 (2)
- RXFP1 (2)
- SERPINA3 (2)
- SIGMAR1 (2)
- SLC11A2 (2)
- SLC2A1 (2)
- SLC44A1 (2)
- SNAI1 (2)
- ST6GAL1 (2)
- STAT5A (2)
- TFAM (2)
- TSG101 (2)
- VCL (2)
- VEGFA (2)
- ZEB2 (2)
- A1CF (1)
- ABCB4 (1)
- ABCC2 (1)
- ABCC3 (1)
- ABCC4 (1)
- ABCC5 (1)
- ABCD2 (1)
- ACAN (1)
- ACER1 (1)
- ACSL3 (1)
- ACSL4 (1)
- ACTA2 (1)
- ACTG2 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS16 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- AGL (1)
- AGPAT2 (1)
- AHCY (1)
- AHSP (1)
- AICDA (1)
Reactivities
- Human (634)
- Mouse (452)
- Rat (358)
- Bovine (30)
- Pig (14)
- Monkey (13)
- Xenopus (12)
- Chicken (9)
- Dog (9)
- Hamster (8)
- Gorilla (6)
- Rabbit (6)
- Rhesus Monkey (6)
- Zebrafish (6)
- Chimpanzee (5)
- Porcine (4)
- Primate (4)
- X. tropicalis (4)
- Cow (3)
- Drosophila (3)
- Horse (3)
- Bat (2)
- Canine (2)
- Sheep (2)
- C. elegans (1)
- Eukaryote (1)
- Feline (1)
- Gibbon (1)
- Goat (1)
- Mink (1)
- Murine (1)
- Orang-Utan (1)
- Streptococcus Pyogenes (1)
- Tadpole (1)
Applications
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Families
- Druggable Genome (505)
- Transmembrane (247)
- Transcription Factors (96)
- ES Cell Differentiation/IPS (83)
- Secreted Protein (74)
- Protein Kinase (56)
- GPCR (33)
- Protease (24)
- Stem cell - Pluripotency (23)
- Adult stem cells (16)
- Embryonic stem cells (14)
- Cancer stem cells (12)
- Induced pluripotent stem cells (10)
- Stem cell relevant signaling - DSL/Notch pathway (8)
- Ion Channels: Transient receptor potential (7)
- Nuclear Hormone Receptor (7)
- P450 (7)
- Stem cell relevant signaling - JAK/STAT signaling pathway (6)
- Phosphatase (4)
- Ion Channels: Glutamate Receptors (3)
- Ion Channels: Other (3)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)
- Ion Channels: Cys-loop Receptors (2)
- Ion Channels: ATP Receptors (1)
- Ion Channels: Calcium (1)
- Ion Channels: Potassium (1)
Pathways
- Pathways in cancer (90)
- Metabolic pathways (69)
- Focal adhesion (65)
- MAPK signaling pathway (43)
- Regulation of actin cytoskeleton (37)
- Chemokine signaling pathway (36)
- Leukocyte transendothelial migration (35)
- Neurotrophin signaling pathway (35)
- Colorectal cancer (34)
- Pancreatic cancer (34)
- Cytokine-cytokine receptor interaction (32)
- Small cell lung cancer (30)
- Toll-like receptor signaling pathway (30)
- Neuroactive ligand-receptor interaction (29)
- Prostate cancer (29)
- Alzheimer's disease (27)
- Huntington's disease (26)
- Adipocytokine signaling pathway (25)
- Apoptosis (25)
- Chronic myeloid leukemia (25)
- Insulin signaling pathway (25)
- Axon guidance (24)
- Endocytosis (24)
- ErbB signaling pathway (24)
- Renal cell carcinoma (24)
- Adherens junction (23)
- Natural killer cell mediated cytotoxicity (23)
- VEGF signaling pathway (23)
- ECM-receptor interaction (22)
- Glioma (22)
- T cell receptor signaling pathway (22)
- p53 signaling pathway (22)
- Amyotrophic lateral sclerosis (ALS) (21)
- Cell adhesion molecules (CAMs) (21)
- Jak-STAT signaling pathway (21)
- Melanoma (21)
- Wnt signaling pathway (21)
- Calcium signaling pathway (20)
- Acute myeloid leukemia (19)
- Non-small cell lung cancer (19)
- Progesterone-mediated oocyte maturation (19)
- RIG-I-like receptor signaling pathway (19)
- B cell receptor signaling pathway (18)
- Endometrial cancer (18)
- Fc epsilon RI signaling pathway (18)
- Cell cycle (17)
- Epithelial cell signaling in Helicobacter pylori infection (17)
- Hematopoietic cell lineage (17)
- Viral myocarditis (17)
- Bladder cancer (16)
- NOD-like receptor signaling pathway (16)
- Tight junction (16)
- Type II diabetes mellitus (16)
- Fc gamma R-mediated phagocytosis (15)
- Vascular smooth muscle contraction (15)
- Dilated cardiomyopathy (14)
- Glycolysis / Gluconeogenesis (14)
- GnRH signaling pathway (14)
- Pathogenic Escherichia coli infection (14)
- Gap junction (13)
- Hypertrophic cardiomyopathy (HCM) (13)
- mTOR signaling pathway (13)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (12)
- Cytosolic DNA-sensing pathway (12)
- Melanogenesis (12)
- Parkinson's disease (12)
- TGF-beta signaling pathway (12)
- Lysosome (11)
- ABC transporters (10)
- Long-term depression (10)
- Long-term potentiation (10)
- Oocyte meiosis (10)
- Prion diseases (10)
- PPAR signaling pathway (9)
- Type I diabetes mellitus (9)
- Thyroid cancer (8)
- Antigen processing and presentation (7)
- Complement and coagulation cascades (7)
- Sphingolipid metabolism (7)
- Systemic lupus erythematosus (7)
- Allograft rejection (6)
- Basal cell carcinoma (6)
- Dorso-ventral axis formation (6)
- Drug metabolism - cytochrome P450 (6)
- Metabolism of xenobiotics by cytochrome P450 (6)
- Oxidative phosphorylation (6)
- Porphyrin and chlorophyll metabolism (6)
- Purine metabolism (6)
- Starch and sucrose metabolism (6)
- Ubiquitin mediated proteolysis (6)
- Autoimmune thyroid disease (5)
- Cardiac muscle contraction (5)
- Fructose and mannose metabolism (5)
- Graft-versus-host disease (5)
- Notch signaling pathway (5)
- Olfactory transduction (5)
- Phosphatidylinositol signaling system (5)
- Primary immunodeficiency (5)
- Retinol metabolism (5)
- Tyrosine metabolism (5)
- Vibrio cholerae infection (5)
- Arginine and proline metabolism (4)
- Citrate cycle (TCA cycle) (4)
- Cysteine and methionine metabolism (4)
- Fatty acid metabolism (4)
- Galactose metabolism (4)
- Inositol phosphate metabolism (4)
- Tryptophan metabolism (4)
- Alanine (3)
- Androgen and estrogen metabolism (3)
- Asthma (3)
- Butanoate metabolism (3)
- Glycerophospholipid metabolism (3)
- Hedgehog signaling pathway (3)
- Homologous recombination (3)
- N-Glycan biosynthesis (3)
- Primary bile acid biosynthesis (3)
- Pyruvate metabolism (3)
- Regulation of autophagy (3)
- Renin-angiotensin system (3)
- SNARE interactions in vesicular transport (3)
- Taurine and hypotaurine metabolism (3)
- Valine (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Base excision repair (2)
- Biosynthesis of unsaturated fatty acids (2)
- DNA replication (2)
- Drug metabolism - other enzymes (2)
- Ether lipid metabolism (2)
- Folate biosynthesis (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Linoleic acid metabolism (2)
- Maturity onset diabetes of the young (2)
- Methane metabolism (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Pentose phosphate pathway (2)
- RNA degradation (2)
- Selenoamino acid metabolism (2)
- Spliceosome (2)
- Vitamin B6 metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Arachidonic acid metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Chondroitin sulfate biosynthesis (1)
- Circadian rhythm - mammal (1)
- Glutathione metabolism (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glycosaminoglycan degradation (1)
- Heparan sulfate biosynthesis (1)
- Non-homologous end-joining (1)
- Nucleotide excision repair (1)
- O-Glycan biosynthesis (1)
- Other glycan degradation (1)
- Pentose and glucuronate interconversions (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyrimidine metabolism (1)
- RNA polymerase (1)
- Riboflavin metabolism (1)
- Ribosome (1)
- Steroid biosynthesis (1)
- Taste transduction (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- alpha-Linolenic acid metabolism (1)
- serine and threonine metabolism (1)