Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit Polyclonal Anti-SDHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Huntington's disease
Filter by
Category
Target Symbol
- TP53 (49)
- CASP9 (25)
- CREB1 (25)
- CASP3 (24)
- GRIN1 (19)
- HDAC2 (19)
- BAX (18)
- HDAC1 (18)
- CASP8 (17)
- GRIN2B (16)
- PPARG (13)
- BBC3 (11)
- SP1 (11)
- APAF1 (10)
- BDNF (10)
- EP300 (9)
- SOD2 (9)
- COX4I1 (8)
- CYCS (8)
- SOD1 (8)
- CREBBP (7)
- DCTN2 (7)
- GRM5 (7)
- PPARGC1A (7)
- TGM2 (7)
- AP2B1 (6)
- NDUFV2 (6)
- NRF1 (6)
- VDAC1 (6)
- COX6B1 (5)
- DNAL1 (5)
- NDUFA8 (5)
- NDUFA9 (5)
- NDUFS1 (5)
- NDUFS8 (5)
- TBP (5)
- TFAM (5)
- VDAC2 (5)
- AP2M1 (4)
- ATP5F1D (4)
- ATP5PF (4)
- COX5B (4)
- DLG4 (4)
- NDUFA10 (4)
- NDUFA4 (4)
- NDUFB10 (4)
- NDUFB9 (4)
- NDUFS4 (4)
- PLCB3 (4)
- POLR2A (4)
- POLR2B (4)
- POLR2G (4)
- POLR2I (4)
- SDHA (4)
- SDHB (4)
- SLC25A4 (4)
- UCP1 (4)
- AP2A2 (3)
- ATP5F1A (3)
- ATP5PD (3)
- COX5A (3)
- COX6A2 (3)
- COX7A1 (3)
- COX7A2 (3)
- COX7B (3)
- CREB3 (3)
- CREB3L1 (3)
- CREB3L2 (3)
- CYC1 (3)
- DCTN1 (3)
- DNAI2 (3)
- DNALI1 (3)
- NDUFA3 (3)
- NDUFC2 (3)
- NDUFS2 (3)
- NDUFS3 (3)
- NDUFS5 (3)
- NDUFV1 (3)
- PLCB1 (3)
- POLR2C (3)
- POLR2E (3)
- POLR2J (3)
- PPID (3)
- RCOR1 (3)
- SLC25A31 (3)
- SLC25A6 (3)
- TAF4 (3)
- TBPL2 (3)
- UQCRFS1 (3)
- VDAC3 (3)
- AP2A1 (2)
- AP2S1 (2)
- ATP5F1B (2)
- ATP5MC1 (2)
- ATP5MC2 (2)
- ATP5PB (2)
- CLTA (2)
- CLTB (2)
- COX4I2 (2)
- COX6C (2)
Reactivities
- Human (552)
- Mouse (357)
- Rat (299)
- Bovine (25)
- Monkey (13)
- Chimpanzee (10)
- Chicken (8)
- Pig (8)
- Rhesus Monkey (8)
- Xenopus (7)
- Dog (6)
- Canine (5)
- Gerbil (5)
- Rabbit (5)
- Hamster (3)
- Sheep (3)
- X. tropicalis (3)
- Macaque (2)
- Primate (2)
- Coral (1)
- Cow (1)
- Drosophila (1)
- Feline (1)
- Guinea Pig (1)
- Yeast (1)
- Zebrafish (1)
Applications
Clonalities
Conjugates
Modifications
Assay Types
Families
- Druggable Genome (455)
- Transcription Factors (221)
- Transmembrane (128)
- Stem cell - Pluripotency (125)
- Protease (70)
- ES Cell Differentiation/IPS (45)
- Ion Channels: Glutamate Receptors (35)
- Adult stem cells (28)
- Stem cell relevant signaling - DSL/Notch pathway (18)
- Ion Channels: Other (14)
- Nuclear Hormone Receptor (13)
- Stem cell relevant signaling - JAK/STAT signaling pathway (11)
- Embryonic stem cells (10)
- Induced pluripotent stem cells (10)
- Secreted Protein (10)
- GPCR (7)
- Ion Channels: Transient receptor potential (2)