Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
USD 440.00
2 Weeks
IL1 Receptor I (IL1R1) (Extracell. Dom.) mouse monoclonal antibody, clone 40101, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- MAP2K1 (183)
- TP53 (149)
- MAP2K3 (98)
- AKT1 (73)
- JUN (67)
- EGFR (59)
- MEF2C (56)
- PPP5C (51)
- FOS (42)
- HSPA1A (38)
- GADD45G (37)
- MAP2K4 (32)
- MYC (32)
- BRAF (30)
- CD14 (30)
- MAPK1 (29)
- MAPK9 (28)
- HRAS (27)
- MAPK8 (26)
- MAPT (24)
- RELA (24)
- CASP3 (22)
- FGFR2 (22)
- PAK1 (20)
- RASGRP3 (20)
- FGF21 (19)
- MAP2K2 (19)
- MAPK13 (19)
- TNF (19)
- CHP1 (17)
- NTF3 (17)
- PDGFRA (17)
- PDGFRB (17)
- EGF (16)
- IL1A (16)
- HSPB1 (15)
- STMN1 (14)
- AKT2 (13)
- CHUK (13)
- IKBKG (13)
- MAPK14 (13)
- DDIT3 (12)
- STK3 (12)
- AKT3 (11)
- ATF2 (11)
- FGFR3 (11)
- MAP3K8 (11)
- NTRK2 (11)
- PTPN7 (11)
- RAF1 (11)
- FGF2 (10)
- HSPA8 (10)
- MAP3K5 (10)
- NTRK1 (10)
- PPP3CA (10)
- BDNF (9)
- NFKB1 (9)
- PRKCA (9)
- TGFBR2 (9)
- FGFR1 (8)
- MAPK3 (8)
- NRAS (8)
- JUND (7)
- NR4A1 (7)
- NTF4 (7)
- PDGFB (7)
- RPS6KA1 (7)
- TRAF2 (7)
- DUSP10 (6)
- FASLG (6)
- GRB2 (6)
- IL1B (6)
- MAP2K6 (6)
- MAPK12 (6)
- MAPK8IP1 (6)
- MAPKAPK2 (6)
- PDGFA (6)
- TGFB1 (6)
- TNFRSF1A (6)
- ARRB1 (5)
- DUSP1 (5)
- ELK1 (5)
- FGF13 (5)
- IKBKB (5)
- NFATC4 (5)
- NGF (5)
- PAK2 (5)
- PPM1B (5)
- RPS6KA5 (5)
- TRAF6 (5)
- ATF4 (4)
- CACNA1C (4)
- CRK (4)
- CRKL (4)
- DUSP6 (4)
- FGF1 (4)
- FGF4 (4)
- FGF7 (4)
- IL1R1 (4)
- MAP3K14 (4)
Reactivities
- Human (1780)
- Mouse (1447)
- Rat (1372)
- Dog (426)
- Monkey (399)
- Bovine (27)
- Pig (14)
- Chicken (13)
- Rabbit (11)
- Xenopus (10)
- Hamster (6)
- Rhesus Monkey (6)
- Cow (5)
- Primate (5)
- X. tropicalis (5)
- Canine (4)
- Horse (4)
- Guinea Pig (3)
- Sheep (3)
- Zebrafish (3)
- Bat (2)
- Drosophila (2)
- Equine (2)
- Feline (2)
- Fish (2)
- Beluga (1)
- C. elegans (1)
- Carp (1)
- Gerbil (1)
- Gibbon (1)
- Gorilla (1)
- Macaque (1)
- Porcine (1)
- Yeast (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1816)
- Protein Kinase (947)
- Transcription Factors (657)
- ES Cell Differentiation/IPS (444)
- Transmembrane (293)
- Secreted Protein (246)
- Stem cell - Pluripotency (220)
- Adult stem cells (142)
- Embryonic stem cells (115)
- Stem cell relevant signaling - JAK/STAT signaling pathway (91)
- Phosphatase (63)
- Induced pluripotent stem cells (61)
- Cancer stem cells (59)
- Stem cell relevant signaling - Wnt Signaling pathway (36)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (32)
- Protease (22)
- Ion Channels: Calcium (11)
- Nuclear Hormone Receptor (7)
- Ion Channels: Other (6)