Primary Antibodies

View as table Download

TIA1 mouse monoclonal antibody, clone 2G9A10F5, Purified

Applications IHC
Reactivities Human

Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSH6 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human MSH6

Rabbit Polyclonal Anti-MSH6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR

Rabbit anti-RPA2 Polyclonal Antibody

Applications ChIP, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPA2

LIG1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human LIG1

Goat Polyclonal Anti-PCNA Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1.

Rabbit polyclonal anti-MtSSB antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MtSSB.

Rabbit anti-POLD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLD1

Rabbit anti-RFC4 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RFC4

Rabbit Polyclonal Anti-MLH1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MLH1

Rabbit Polyclonal Anti-MSH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG

Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694)

Rabbit polyclonal anti-PCNA antibody, Loading control

Applications WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human PCNA

Rabbit anti-MLH1 Polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human MLH1

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

MSH2 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MSH2

Rabbit anti-MSH3 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human MSH3

Rabbit Polyclonal Anti-MLH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLH3 antibody: synthetic peptide directed towards the middle region of human MLH3. Synthetic peptide located within the following region: SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP

Rabbit Polyclonal MLH1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal RFC4 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal PMS2 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

MLH1 mouse monoclonal antibody, clone n.a, Ascites

Applications ELISA, IF, IHC, WB
Reactivities Human, Monkey

SSBP1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

MLH1 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 450-500 of Human MLH1.

Rabbit monoclonal antibody against MLH1(clone EPR3893)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-PCNA antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PCNA.

Rabbit polyclonal PCNA Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA.

Rabbit Polyclonal Anti-MSH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV

Mouse Monoclonal MLH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal MSH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal RPA70 Antibody

Applications IF, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PCNA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA

PCNA mouse monoclonal antibody, clone IML-83, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

MSH6 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249)

Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244)

Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927)

Rabbit polyclonal anti-MLH1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MLH1.

Rabbit polyclonal RFA2 (Ab-21) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S).

Rabbit polyclonal anti-RFC2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RFC2.

Rabbit polyclonal anti-MSH6 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MSH6.

Rabbit polyclonal anti-MLH3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MLH3.

Anti-MSH6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human mutS homolog 6 (E. coli)

Rabbit polyclonal MSH2 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MSH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 637-665 amino acids from the Central region of human MSH2.

Rabbit Polyclonal RFA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human RFA2