Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
Download
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit anti-SLC3A2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC3A2 |
Rabbit Polyclonal Anti-NPY1R Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Transmembrane
Filter by
Target Symbol
- BAX (8)
- APP (7)
- BCL2L1 (6)
- BDNF (6)
- GRIA2 (6)
- GRM1 (6)
- KDR (6)
- AIFM1 (5)
- CXCR4 (5)
- DIABLO (5)
- FGFR3 (5)
- MME (5)
- RTN4 (5)
- TLR4 (5)
- TRPC3 (5)
- TRPM8 (5)
- ACE2 (4)
- ADRA1B (4)
- APLNR (4)
- ATP7B (4)
- CANX (4)
- CDH1 (4)
- CHRM1 (4)
- CLDN1 (4)
- CLDN5 (4)
- CLDN7 (4)
- CSF1R (4)
- EDA (4)
- EGFR (4)
- EIF2AK3 (4)
- FGFR2 (4)
- GJB6 (4)
- GRIK1 (4)
- GRIN1 (4)
- GRPR (4)
- HMOX1 (4)
- HTR2C (4)
- IGF1R (4)
- IL23R (4)
- MAVS (4)
- MC4R (4)
- MERTK (4)
- MUC1 (4)
- NGFR (4)
- NPHS1 (4)
- NPY1R (4)
- NTRK1 (4)
- NTRK2 (4)
- SCN11A (4)
- SHH (4)
- SLC2A1 (4)
- SPAG4 (4)
- TLR1 (4)
- TLR2 (4)
- TNFSF13 (4)
- TRPA1 (4)
- TRPC6 (4)
- TRPM7 (4)
- ABCB5 (3)
- ABCG1 (3)
- ACVR1C (3)
- ADAM15 (3)
- ADGRB1 (3)
- ADIPOR1 (3)
- AGTR2 (3)
- ANPEP (3)
- AQP1 (3)
- AQP2 (3)
- AQP3 (3)
- B3GAT1 (3)
- BAI2 (3)
- BCAP31 (3)
- BCL2 (3)
- BDKRB2 (3)
- BNIP3L (3)
- CADM3 (3)
- CCR3 (3)
- CD151 (3)
- CD44 (3)
- CDH5 (3)
- CERS5 (3)
- CFTR (3)
- CLDN10 (3)
- CLDN4 (3)
- CNGA2 (3)
- CPT1A (3)
- CXCR3 (3)
- CYP2E1 (3)
- CYP3A4 (3)
- DDR1 (3)
- ECE1 (3)
- EPOR (3)
- ERBB2 (3)
- ERBB3 (3)
- FAIM2 (3)
- GABRA3 (3)
- GJA1 (3)
- GLG1 (3)
- GRIA3 (3)
- GRM3 (3)
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (245)
- Cytokine-cytokine receptor interaction (165)
- Pathways in cancer (134)
- Calcium signaling pathway (120)
- Metabolic pathways (108)
- Cell adhesion molecules (CAMs) (93)
- Endocytosis (74)
- MAPK signaling pathway (65)
- Regulation of actin cytoskeleton (59)
- Alzheimer's disease (58)
- Hematopoietic cell lineage (58)
- Leukocyte transendothelial migration (53)
- Colorectal cancer (52)
- Focal adhesion (51)
- Melanogenesis (48)
- Jak-STAT signaling pathway (46)
- Gap junction (44)
- Amyotrophic lateral sclerosis (ALS) (41)
- Adherens junction (40)
- Dilated cardiomyopathy (39)
- Wnt signaling pathway (39)
- Apoptosis (37)
- Axon guidance (36)
- Chemokine signaling pathway (36)
- Toll-like receptor signaling pathway (35)
- ABC transporters (34)
- Basal cell carcinoma (34)
- Neurotrophin signaling pathway (34)
- Vascular smooth muscle contraction (33)
- Pancreatic cancer (32)
- Huntington's disease (30)
- Hypertrophic cardiomyopathy (HCM) (29)
- ECM-receptor interaction (28)
- Long-term potentiation (28)
- Prostate cancer (28)
- TGF-beta signaling pathway (28)
- Hedgehog signaling pathway (27)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (26)
- Tight junction (26)
- Adipocytokine signaling pathway (24)
- Melanoma (24)
- Long-term depression (23)
- Natural killer cell mediated cytotoxicity (23)
- Chronic myeloid leukemia (21)
- ErbB signaling pathway (20)
- GnRH signaling pathway (20)
- Lysosome (20)
- Renin-angiotensin system (20)
- Purine metabolism (19)
- Bladder cancer (18)
- Pathogenic Escherichia coli infection (18)
- Notch signaling pathway (17)
- Small cell lung cancer (17)
- p53 signaling pathway (17)
- Glioma (16)
- Oocyte meiosis (15)
- Parkinson's disease (15)
- Cardiac muscle contraction (14)
- Metabolism of xenobiotics by cytochrome P450 (14)
- Progesterone-mediated oocyte maturation (14)
- Antigen processing and presentation (13)
- Drug metabolism - cytochrome P450 (13)
- Endometrial cancer (13)
- N-Glycan biosynthesis (13)
- PPAR signaling pathway (13)
- Renal cell carcinoma (13)
- Retinol metabolism (13)
- T cell receptor signaling pathway (13)
- Epithelial cell signaling in Helicobacter pylori infection (12)
- Primary immunodeficiency (12)
- SNARE interactions in vesicular transport (12)
- Complement and coagulation cascades (11)
- Non-small cell lung cancer (11)
- Prion diseases (11)
- Type II diabetes mellitus (11)
- Viral myocarditis (11)
- Arachidonic acid metabolism (10)
- Taste transduction (10)
- Thyroid cancer (10)
- Oxidative phosphorylation (9)
- Systemic lupus erythematosus (9)
- Tyrosine metabolism (9)
- Vibrio cholerae infection (9)
- Allograft rejection (8)
- Autoimmune thyroid disease (8)
- Graft-versus-host disease (8)
- Linoleic acid metabolism (8)
- RIG-I-like receptor signaling pathway (8)
- Tryptophan metabolism (8)
- Type I diabetes mellitus (8)
- Chondroitin sulfate biosynthesis (7)
- Glutathione metabolism (7)
- Glycosphingolipid biosynthesis - lacto and neolacto series (7)
- Heparan sulfate biosynthesis (7)
- Porphyrin and chlorophyll metabolism (7)
- Pyrimidine metabolism (7)
- Sphingolipid metabolism (7)
- Asthma (6)
- Cytosolic DNA-sensing pathway (6)
- Dorso-ventral axis formation (6)
- Fatty acid metabolism (6)
- Fc gamma R-mediated phagocytosis (6)
- Glycerolipid metabolism (6)
- Glycerophospholipid metabolism (6)
- Nicotinate and nicotinamide metabolism (6)
- VEGF signaling pathway (6)
- Drug metabolism - other enzymes (5)
- Ether lipid metabolism (5)
- O-Glycan biosynthesis (5)
- Riboflavin metabolism (5)
- Androgen and estrogen metabolism (4)
- B cell receptor signaling pathway (4)
- Biosynthesis of unsaturated fatty acids (4)
- Cell cycle (4)
- Insulin signaling pathway (4)
- Olfactory transduction (4)
- Primary bile acid biosynthesis (4)
- Starch and sucrose metabolism (4)
- Steroid biosynthesis (4)
- Acute myeloid leukemia (3)
- Fc epsilon RI signaling pathway (3)
- Inositol phosphate metabolism (3)
- Keratan sulfate biosynthesis (3)
- NOD-like receptor signaling pathway (3)
- Ubiquitin mediated proteolysis (3)
- Arginine and proline metabolism (2)
- Ascorbate and aldarate metabolism (2)
- Caffeine metabolism (2)
- Cyanoamino acid metabolism (2)
- Glycine (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Histidine metabolism (2)
- Nitrogen metabolism (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Phenylalanine metabolism (2)
- Phosphatidylinositol signaling system (2)
- Propanoate metabolism (2)
- Selenoamino acid metabolism (2)
- Taurine and hypotaurine metabolism (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- serine and threonine metabolism (2)
- C21-Steroid hormone metabolism (1)
- Glycosaminoglycan degradation (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Maturity onset diabetes of the young (1)
- O-Mannosyl glycan biosynthesis (1)
- Terpenoid backbone biosynthesis (1)