Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPP1R10 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R10 antibody: synthetic peptide directed towards the N terminal of human PPP1R10. Synthetic peptide located within the following region: SQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKP |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit Polyclonal Anti-SYNJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal Anti-CTDSPL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit Polyclonal Anti-PPP2R5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW |
USD 524.00
In Stock
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
CDC25C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25C |
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
Rabbit anti-PPM1D Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPM1D |
Rabbit Polyclonal Anti-SYNJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP |
Rabbit Polyclonal Anti-DUSP22 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DUSP22 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP22. Synthetic peptide located within the following region: LPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADS |
Rabbit Polyclonal Anti-SYNJ2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL |
Rabbit Polyclonal Anti-MTMR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY |
Rabbit Monoclonal Antibody against PTPN11 (Clone Y477)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal SIRP alpha Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SIRP alpha antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human SIRP alpha 1? The sequences of the immunogenic peptide differ from those of mouse, rat and bovine by one amino acid. |
Rabbit Polyclonal antibody to CTDSP2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 26 and 271 of CTDSP2 (Uniprot ID#O14595) |
Rabbit polyclonal anti-PTPRZ1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PTPRZ1. |
Rabbit polyclonal anti-PTPN22 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTPN22. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Families
- Phosphatase
Filter by
Target Symbol
- CDC25A (18)
- PTEN (14)
- PTPN11 (14)
- CDC25B (8)
- CDC25C (7)
- DUSP1 (7)
- PPP1CB (6)
- PTPN6 (5)
- ACPP (4)
- DUSP4 (4)
- PPP2R1A (4)
- PPP3CA (4)
- PTP4A2 (4)
- PTPN2 (4)
- PTPN22 (4)
- SIRPA (4)
- CTDSP2 (3)
- DUSP12 (3)
- DUSP16 (3)
- DUSP19 (3)
- DUSP6 (3)
- DUSP8 (3)
- EPM2A (3)
- ILKAP (3)
- PDP2 (3)
- PNKP (3)
- PPP1CA (3)
- PPP1CC (3)
- PPP2CA (3)
- PPP2R2A (3)
- PPP2R3B (3)
- PSPH (3)
- PTP4A3 (3)
- PTPA (3)
- PTPN1 (3)
- PTPRC (3)
- PTPRR (3)
- ACP1 (2)
- CDC14A (2)
- CTDSP1 (2)
- DAPP1 (2)
- DUSP10 (2)
- DUSP22 (2)
- DUSP5 (2)
- DUSP9 (2)
- EYA1 (2)
- EYA3 (2)
- INPP5K (2)
- PPFIA1 (2)
- PPM1D (2)
- PPM1F (2)
- PPM1J (2)
- PPM1K (2)
- PPM1L (2)
- PPM1M (2)
- PPP1R3A (2)
- PPP1R7 (2)
- PPP2R1B (2)
- PPP2R3A (2)
- PPP2R5A (2)
- PPP2R5D (2)
- PPP3CB (2)
- PPP4C (2)
- PPP4R2 (2)
- PPP6C (2)
- PPTC7 (2)
- PTN (2)
- PTPN12 (2)
- PTPN13 (2)
- PTPN20 (2)
- PTPN5 (2)
- SET (2)
- SSH3 (2)
- SYNJ1 (2)
- CDKN3 (1)
- CILP (1)
- CTDP1 (1)
- CTDSPL (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP2 (1)
- DUSP26 (1)
- DUSP3 (1)
- DUSP7 (1)
- MTMR1 (1)
- MTMR14 (1)
- MTMR6 (1)
- MTMR7 (1)
- MTMR9 (1)
- PDP1 (1)
- PPEF1 (1)
- PPFIA4 (1)
- PPM1A (1)
- PPM1B (1)
- PPM1H (1)
- PPP1R10 (1)
- PPP1R1C (1)
- PPP1R3B (1)
- PPP2CB (1)
- PPP2R5B (1)
Clonalities
Conjugates
Modifications
Pathways
- MAPK signaling pathway (54)
- Oocyte meiosis (44)
- Cell cycle (35)
- Progesterone-mediated oocyte maturation (33)
- Natural killer cell mediated cytotoxicity (27)
- Tight junction (27)
- Focal adhesion (26)
- Wnt signaling pathway (25)
- Insulin signaling pathway (20)
- Long-term potentiation (20)
- Inositol phosphate metabolism (19)
- Jak-STAT signaling pathway (19)
- Phosphatidylinositol signaling system (19)
- T cell receptor signaling pathway (16)
- p53 signaling pathway (16)
- B cell receptor signaling pathway (15)
- Epithelial cell signaling in Helicobacter pylori infection (15)
- Adipocytokine signaling pathway (14)
- Chronic myeloid leukemia (14)
- Endometrial cancer (14)
- Glioma (14)
- Leukocyte transendothelial migration (14)
- Melanoma (14)
- Neurotrophin signaling pathway (14)
- Pathways in cancer (14)
- Prostate cancer (14)
- Regulation of actin cytoskeleton (14)
- Renal cell carcinoma (14)
- Small cell lung cancer (14)
- Adherens junction (12)
- Vascular smooth muscle contraction (12)
- Metabolic pathways (11)
- Long-term depression (10)
- TGF-beta signaling pathway (10)
- Riboflavin metabolism (9)
- Alzheimer's disease (8)
- Amyotrophic lateral sclerosis (ALS) (8)
- Apoptosis (8)
- Axon guidance (8)
- Calcium signaling pathway (8)
- VEGF signaling pathway (8)
- Cell adhesion molecules (CAMs) (4)
- Fc gamma R-mediated phagocytosis (3)
- Fructose and mannose metabolism (3)
- Glycine (3)
- Primary immunodeficiency (3)
- Thiamine metabolism (3)
- serine and threonine metabolism (3)
- Sphingolipid metabolism (1)
- Type I diabetes mellitus (1)