Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-POLR2C antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C. |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit polyclonal antibody to dynactin 1 (dynactin 1 (p150, glued homolog, Drosophila))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1216 and 1278 of DCTN1 (Uniprot ID#Q14203) |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Pathways
- Huntington's disease
Filter by
Target Symbol
- CREB1 (20)
- HDAC2 (16)
- TP53 (14)
- CASP3 (13)
- CASP9 (13)
- BAX (12)
- HDAC1 (12)
- GRIN1 (11)
- GRIN2B (10)
- PPARG (8)
- PPARGC1A (7)
- SOD2 (7)
- APAF1 (6)
- BBC3 (6)
- BDNF (6)
- SP1 (6)
- CYCS (5)
- NDUFV2 (5)
- NRF1 (5)
- SOD1 (5)
- TGM2 (5)
- CASP8 (4)
- COX5B (4)
- CREBBP (4)
- DLG4 (4)
- GRM5 (4)
- NDUFA9 (4)
- NDUFS1 (4)
- ATP5F1D (3)
- ATP5PF (3)
- COX4I1 (3)
- DCTN1 (3)
- DCTN2 (3)
- DNAL1 (3)
- EP300 (3)
- NDUFA3 (3)
- NDUFA8 (3)
- NDUFB9 (3)
- POLR2C (3)
- POLR2G (3)
- TBP (3)
- VDAC1 (3)
- AP2M1 (2)
- AP2S1 (2)
- COX4I2 (2)
- COX5A (2)
- COX6B1 (2)
- COX6C (2)
- COX7B (2)
- CREB3L2 (2)
- NDUFA4 (2)
- NDUFA5 (2)
- NDUFS2 (2)
- NDUFS4 (2)
- NDUFS6 (2)
- NDUFS7 (2)
- NDUFS8 (2)
- NDUFV1 (2)
- PLCB1 (2)
- PLCB3 (2)
- POLR2A (2)
- POLR2D (2)
- POLR2I (2)
- SDHA (2)
- SDHB (2)
- SLC25A4 (2)
- TFAM (2)
- UQCRC1 (2)
- VDAC2 (2)
- AP2A1 (1)
- AP2A2 (1)
- AP2B1 (1)
- ATP5F1A (1)
- ATP5F1B (1)
- ATP5MC1 (1)
- ATP5PB (1)
- ATP5PD (1)
- CLTC (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7B2 (1)
- COX8A (1)
- CYC1 (1)
- DCTN4 (1)
- DNAI2 (1)
- HAP1 (1)
- ITPR1 (1)
- LCMT2 (1)
- NDUFA1 (1)
- NDUFA2 (1)
- NDUFA4L2 (1)
- NDUFA6 (1)
- NDUFAB1 (1)
- NDUFB10 (1)
- NDUFS3 (1)
- NDUFS5 (1)
- PLCB2 (1)
- POLR2E (1)
- POLR2H (1)
Applications
Clonalities
Conjugates
Modifications
Assay Types
Families
- Druggable Genome (250)
- Transcription Factors (119)
- Transmembrane (65)
- Stem cell - Pluripotency (61)
- Protease (33)
- ES Cell Differentiation/IPS (25)
- Ion Channels: Glutamate Receptors (21)
- Adult stem cells (18)
- Stem cell relevant signaling - DSL/Notch pathway (12)
- Nuclear Hormone Receptor (8)
- Embryonic stem cells (6)
- Induced pluripotent stem cells (6)
- Ion Channels: Other (6)
- Secreted Protein (6)
- Stem cell relevant signaling - JAK/STAT signaling pathway (6)
- GPCR (4)
- Ion Channels: Transient receptor potential (1)