Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal DNA Polymerase theta antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
USD 524.00
In Stock
Rabbit Polyclonal Anti-EWSR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS |
Rabbit Polyclonal Anti-FUS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUS antibody: synthetic peptide directed towards the N terminal of human FUS. Synthetic peptide located within the following region: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ANP32A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the N terminal of human NCL. Synthetic peptide located within the following region: GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the C terminal of human NCL. Synthetic peptide located within the following region: GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
Rabbit Polyclonal Anti-FBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Rabbit Polyclonal Anti-NP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Rabbit anti-PARP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PARP1 |
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein. |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Active filters
Antibody Hosts
- Rabbit
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- TP53 (49)
- NPPB (28)
- CASP9 (25)
- CHEK1 (25)
- MYC (24)
- PAK1 (24)
- BCL2 (23)
- PXN (23)
- CCNB1 (22)
- CHEK2 (22)
- CDK1 (20)
- HDAC2 (19)
- LCK (19)
- HDAC1 (18)
- HSP90AB1 (17)
- KIT (17)
- VASP (17)
- HSPD1 (15)
- CCND1 (14)
- ERBB3 (14)
- BIRC5 (13)
- CASP6 (13)
- NANOG (13)
- NFKBIB (13)
- SOCS1 (13)
- CCNE1 (12)
- HMGB1 (12)
- MYB (11)
- PARP1 (11)
- POU5F1 (11)
- RPA2 (11)
- SP1 (11)
- SUMO1 (11)
- MRE11 (10)
- NPM1 (10)
- RAD51 (10)
- ANP32A (9)
- AURKA (9)
- BAK1 (9)
- CDC25C (9)
- CTBP2 (9)
- PCNA (9)
- PIAS2 (9)
- TK1 (9)
- XRCC5 (9)
- ACTA1 (8)
- ANAPC1 (8)
- CDK7 (8)
- DNMT3B (8)
- HSPA9 (8)
- KAT7 (8)
- ANXA2 (7)
- APEX1 (7)
- APOE (7)
- EWSR1 (7)
- GEMIN2 (7)
- GTF2H2 (7)
- MCM3 (7)
- MCM5 (7)
- MUTYH (7)
- PHB (7)
- PRNP (7)
- STIP1 (7)
- TDGF1 (7)
- UNG (7)
- AATF (6)
- AIMP2 (6)
- CCNA2 (6)
- CXADR (6)
- HSPA8 (6)
- HSPH1 (6)
- MCM2 (6)
- MCM6 (6)
- MSH6 (6)
- NCL (6)
- NME1 (6)
- NTHL1 (6)
- OTX2 (6)
- PFN1 (6)
- PNN (6)
- PSMD11 (6)
- RAD9A (6)
- TMPO (6)
- TNNI3 (6)
- TRIP13 (6)
- ATIC (5)
- BAG6 (5)
- CCNB2 (5)
- CDC7 (5)
- DAXX (5)
- FBP1 (5)
- GOT2 (5)
- HMGA1 (5)
- HPRT1 (5)
- HSPE1 (5)
- KPNA2 (5)
- MBD2 (5)
- MNAT1 (5)
- MSH2 (5)
- MYBBP1A (5)
Reactivities
- Human (1243)
- Mouse (703)
- Rat (560)
- Bovine (56)
- Monkey (31)
- Chicken (25)
- Hamster (18)
- Pig (17)
- Dog (15)
- Xenopus (13)
- Rabbit (10)
- Rhesus Monkey (9)
- Chimpanzee (8)
- Sheep (8)
- Primate (6)
- X. tropicalis (6)
- Canine (5)
- Zebrafish (5)
- Cow (2)
- Drosophila (2)
- Feline (2)
- Gerbil (2)
- Goat (2)
- Guinea Pig (2)
- Saccharomyces cerevisiae (2)
- Algal (1)
- Avian (1)
- Baboon (1)
- Canis (1)
- Equine (1)
- Fish (1)
- Horse (1)
- Yeast (1)
Applications
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Cell cycle (327)
- Pathways in cancer (274)
- p53 signaling pathway (207)
- Colorectal cancer (161)
- Small cell lung cancer (158)
- Prostate cancer (140)
- Chronic myeloid leukemia (133)
- Huntington's disease (125)
- MAPK signaling pathway (114)
- Endometrial cancer (112)
- Apoptosis (110)
- Focal adhesion (109)
- Amyotrophic lateral sclerosis (ALS) (102)
- Pancreatic cancer (98)
- Wnt signaling pathway (98)
- Progesterone-mediated oocyte maturation (91)
- Oocyte meiosis (89)
- Non-small cell lung cancer (88)
- Bladder cancer (87)
- Thyroid cancer (87)
- Neurotrophin signaling pathway (85)
- DNA replication (79)
- Metabolic pathways (78)
- Base excision repair (69)
- Nucleotide excision repair (69)
- ErbB signaling pathway (67)
- T cell receptor signaling pathway (66)
- Jak-STAT signaling pathway (65)
- Glioma (63)
- Melanoma (63)
- Mismatch repair (61)
- Regulation of actin cytoskeleton (61)
- Chemokine signaling pathway (60)
- Acute myeloid leukemia (55)
- Basal cell carcinoma (49)
- Homologous recombination (48)
- Natural killer cell mediated cytotoxicity (48)
- VEGF signaling pathway (48)
- Notch signaling pathway (46)
- Viral myocarditis (45)
- Fc gamma R-mediated phagocytosis (44)
- Spliceosome (43)
- Leukocyte transendothelial migration (40)
- Endocytosis (38)
- RNA degradation (38)
- TGF-beta signaling pathway (35)
- Alzheimer's disease (32)
- Ubiquitin mediated proteolysis (32)
- Axon guidance (30)
- NOD-like receptor signaling pathway (30)
- Purine metabolism (30)
- Renal cell carcinoma (29)
- Antigen processing and presentation (28)
- Gap junction (28)
- Parkinson's disease (28)
- Pyrimidine metabolism (28)
- Primary immunodeficiency (26)
- Epithelial cell signaling in Helicobacter pylori infection (24)
- Non-homologous end-joining (24)
- Cytokine-cytokine receptor interaction (22)
- Drug metabolism - other enzymes (19)
- B cell receptor signaling pathway (18)
- Insulin signaling pathway (18)
- Proteasome (18)
- Calcium signaling pathway (17)
- Hematopoietic cell lineage (17)
- Melanogenesis (17)
- Cytosolic DNA-sensing pathway (16)
- Type I diabetes mellitus (15)
- Prion diseases (14)
- Adipocytokine signaling pathway (13)
- Cysteine and methionine metabolism (13)
- RIG-I-like receptor signaling pathway (13)
- Type II diabetes mellitus (13)
- One carbon pool by folate (10)
- Pathogenic Escherichia coli infection (10)
- Systemic lupus erythematosus (8)
- Basal transcription factors (7)
- Cardiac muscle contraction (6)
- Dilated cardiomyopathy (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Adherens junction (5)
- Alanine (5)
- Arginine and proline metabolism (5)
- Fructose and mannose metabolism (5)
- Glycolysis / Gluconeogenesis (5)
- Pentose phosphate pathway (5)
- Phenylalanine (5)
- Phenylalanine metabolism (5)
- Tyrosine metabolism (5)
- aspartate and glutamate metabolism (5)
- tyrosine and tryptophan biosynthesis (5)
- ECM-receptor interaction (4)
- Glycine (4)
- serine and threonine metabolism (4)
- Ether lipid metabolism (3)
- Folate biosynthesis (3)
- Glycerolipid metabolism (3)
- Glycerophospholipid metabolism (3)
- RNA polymerase (3)
- SNARE interactions in vesicular transport (3)
- Sphingolipid metabolism (3)
- Steroid biosynthesis (3)
- Glyoxylate and dicarboxylate metabolism (2)
- Nicotinate and nicotinamide metabolism (2)
- Selenoamino acid metabolism (2)