Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Mouse Monoclonal SMAD5 (C-terminus) Antibody
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Smad2 (Thr220) antibody(Phospho-specific)
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad2 around the phosphorylation site of threonine 220 (P-E-TP-P-P). |
| Modifications | Phospho-specific |
Anti-RPS6KB1 (Phospho-Ser411) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 411 (I-R-S(p)-P-R) derived from Human p70 S6 Kinase. |
| Modifications | Phospho-specific |
Anti-RPS6KB1 (Phospho-Ser424) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 424 (P-V-S(p)-P-V) derived from Human p70 S6 Kinase. |
| Modifications | Phospho-specific |
Rabbit polyclonal PITX2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PITX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-151 amino acids from the C-terminal region of human PITX2. |
Rabbit polyclonal Smad7 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Smad7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 195-224 amino acids from the Central region of human Smad7. |
Rabbit Polyclonal Anti-TFDP1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the N terminal of human TFDP1. Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN |
Rabbit polyclonal SMAD9 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human SMAD9. |
Mouse Monoclonal Noggin Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Smad2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IF
Conjugates
- Unconjugated
Pathways
- TGF-beta signaling pathway
Filter by
Category
Target Symbol
- ID3 (21)
- MYC (17)
- RPS6KB1 (11)
- NOG (10)
- SMAD2 (10)
- MAPK1 (9)
- TNF (8)
- BMP4 (6)
- ID2 (6)
- TGFB1 (6)
- CDKN2B (4)
- MAPK3 (3)
- CUL1 (2)
- ROCK1 (2)
- SMAD3 (2)
- SMAD4 (2)
- SMAD9 (2)
- TFDP1 (2)
- ACVR1B (1)
- ACVR1C (1)
- ACVRL1 (1)
- BMP8A (1)
- BMPR1B (1)
- CREBBP (1)
- INHBA (1)
- PITX2 (1)
- ROCK2 (1)
- SMAD1 (1)
- SMAD5 (1)
- SMAD7 (1)
- SMURF1 (1)
- TGFBR2 (1)
- THBS1 (1)
Reactivities
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (128)
- Transcription Factors (80)
- ES Cell Differentiation/IPS (52)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (43)
- Embryonic stem cells (35)
- Secreted Protein (32)
- Protein Kinase (31)
- Stem cell relevant signaling - JAK/STAT signaling pathway (31)
- Induced pluripotent stem cells (23)
- Cancer stem cells (20)
- Stem cell - Pluripotency (17)
- Stem cell relevant signaling - Wnt Signaling pathway (17)
- Transmembrane (13)
- Adult stem cells (6)