Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human LSD1 (Lysine-specific demethylase 1), using a KLH-conjugated synthetic peptide from the inner part of the protein. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit Polyclonal ASH2 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: mouse Ash2 (absent, small, or homeotic 2), using 3 different KLH-conjugated synthetic peptides, 2 containing an amino acid sequence from the central and 1 containing an amino acid sequence from the C-terminal part of |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit Polyclonal Anti-PPP1R10 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R10 antibody: synthetic peptide directed towards the N terminal of human PPP1R10. Synthetic peptide located within the following region: SQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKP |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit polyclonal LMO4 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LMO4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 104-131 amino acids from the Central region of human LMO4. |
Caldesmon (CALD1) rabbit monoclonal antibody, clone EP19, Supernatant
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal IRF7 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IF
Isotypes
- IgG
Families
- Transcription Factors
Filter by
Target Symbol
- KDM1A (6)
- FOXO4 (5)
- IRF3 (5)
- STAT3 (5)
- TFAM (5)
- ESR1 (4)
- FOXO1 (4)
- GATA3 (4)
- HDAC1 (4)
- HDAC2 (4)
- KLF4 (4)
- SUMO1 (4)
- TARDBP (4)
- TP53 (4)
- XRCC6 (4)
- ATF6 (3)
- BCL6 (3)
- BMI1 (3)
- CTNNB1 (3)
- EED (3)
- ENO1 (3)
- FOXA2 (3)
- FOXO3 (3)
- FOXP3 (3)
- HDAC6 (3)
- HNRNPD (3)
- IKBKB (3)
- IKBKG (3)
- MEF2A (3)
- MYC (3)
- NPM1 (3)
- NR3C1 (3)
- PPARGC1A (3)
- RELA (3)
- SIRT2 (3)
- SMAD2 (3)
- SOX2 (3)
- APEX1 (2)
- ATRX (2)
- BRCA1 (2)
- CBFA2T2 (2)
- CBL (2)
- CBX4 (2)
- CCNE1 (2)
- CERS5 (2)
- CREBZF (2)
- DPF2 (2)
- E2F1 (2)
- EDF1 (2)
- EIF2AK2 (2)
- ERCC8 (2)
- EWSR1 (2)
- FOXG1 (2)
- GATA1 (2)
- GATA6 (2)
- GTF2I (2)
- HDAC5 (2)
- HDAC9 (2)
- HLX (2)
- HMGB1 (2)
- HNF1A (2)
- HOXC10 (2)
- IRX2 (2)
- KEAP1 (2)
- LIN28A (2)
- MCM5 (2)
- MDM2 (2)
- MEOX1 (2)
- MITF (2)
- NKX2-5 (2)
- NONO (2)
- NR1H3 (2)
- OLIG2 (2)
- PGR (2)
- PRKCQ (2)
- PTGER3 (2)
- RBPJ (2)
- REL (2)
- RHOH (2)
- RXRG (2)
- SATB1 (2)
- SATB2 (2)
- SMAD3 (2)
- SMAD9 (2)
- SMARCA4 (2)
- SNAI2 (2)
- SOX17 (2)
- SOX18 (2)
- SOX4 (2)
- SOX9 (2)
- SQSTM1 (2)
- SREBF2 (2)
- STAT1 (2)
- TBX1 (2)
- TBX21 (2)
- TFDP1 (2)
- TFE3 (2)
- TFEB (2)
- TLE5 (2)
- TRIM25 (2)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (76)
- Cell cycle (40)
- Chronic myeloid leukemia (38)
- Prostate cancer (32)
- Pancreatic cancer (30)
- Small cell lung cancer (27)
- MAPK signaling pathway (26)
- Adipocytokine signaling pathway (25)
- Wnt signaling pathway (25)
- Acute myeloid leukemia (23)
- Huntington's disease (23)
- Toll-like receptor signaling pathway (23)
- Neurotrophin signaling pathway (21)
- Chemokine signaling pathway (20)
- RIG-I-like receptor signaling pathway (19)
- T cell receptor signaling pathway (19)
- Colorectal cancer (18)
- Cytosolic DNA-sensing pathway (18)
- TGF-beta signaling pathway (18)
- Apoptosis (16)
- Endometrial cancer (15)
- Jak-STAT signaling pathway (15)
- B cell receptor signaling pathway (14)
- Insulin signaling pathway (14)
- Non-small cell lung cancer (14)
- Thyroid cancer (14)
- Ubiquitin mediated proteolysis (14)
- Adherens junction (13)
- Bladder cancer (13)
- Melanoma (12)
- Notch signaling pathway (12)
- NOD-like receptor signaling pathway (11)
- Epithelial cell signaling in Helicobacter pylori infection (10)
- Glioma (10)
- p53 signaling pathway (10)
- Basal cell carcinoma (9)
- ErbB signaling pathway (9)
- Maturity onset diabetes of the young (9)
- Metabolic pathways (8)
- Oocyte meiosis (8)
- Melanogenesis (7)
- Neuroactive ligand-receptor interaction (7)
- Amyotrophic lateral sclerosis (ALS) (6)
- Tight junction (6)
- Focal adhesion (5)
- Leukocyte transendothelial migration (5)
- PPAR signaling pathway (5)
- RNA degradation (5)
- Renal cell carcinoma (5)
- Type II diabetes mellitus (5)
- Alzheimer's disease (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (4)
- Basal transcription factors (4)
- Base excision repair (4)
- DNA replication (4)
- Endocytosis (4)
- Non-homologous end-joining (4)
- Nucleotide excision repair (4)
- Pathogenic Escherichia coli infection (4)
- Purine metabolism (4)
- Pyrimidine metabolism (4)
- Viral myocarditis (4)
- Allograft rejection (3)
- Antigen processing and presentation (3)
- Axon guidance (3)
- Circadian rhythm - mammal (3)
- Glycolysis / Gluconeogenesis (3)
- GnRH signaling pathway (3)
- Graft-versus-host disease (3)
- Natural killer cell mediated cytotoxicity (3)
- Primary immunodeficiency (3)
- RNA polymerase (3)
- Systemic lupus erythematosus (3)
- Type I diabetes mellitus (3)
- Autoimmune thyroid disease (2)
- Calcium signaling pathway (2)
- Cell adhesion molecules (CAMs) (2)
- Dorso-ventral axis formation (2)
- Progesterone-mediated oocyte maturation (2)
- VEGF signaling pathway (2)
- Vascular smooth muscle contraction (2)
- Asthma (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Fc epsilon RI signaling pathway (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Hedgehog signaling pathway (1)
- Hematopoietic cell lineage (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Prion diseases (1)
- Proteasome (1)
- SNARE interactions in vesicular transport (1)
- Spliceosome (1)
- mTOR signaling pathway (1)
- serine and threonine metabolism (1)