Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Antibodies
Download
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS |
Rabbit Polyclonal Antibody against PHPT1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1. |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
Rabbit polyclonal FASN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
Rabbit Polyclonal Anti-GPT Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT |
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Pathways
- Metabolic pathways
Availabilities
- In Stock
Filter by
Target Symbol
- NME1 (58)
- OTC (46)
- LIPG (43)
- PIK3C2A (28)
- TYMP (25)
- ABAT (24)
- AMACR (22)
- TYMS (20)
- GCH1 (19)
- IDO1 (18)
- ACAA2 (17)
- CYP1A2 (17)
- LTA4H (17)
- HADH (16)
- UPRT (16)
- GBA (15)
- RRM1 (15)
- CMPK1 (14)
- TH (14)
- FTCD (13)
- PFKP (13)
- MGLL (12)
- AKR1A1 (11)
- AMDHD1 (10)
- ATP5F1B (10)
- NDUFB10 (10)
- NME4 (10)
- ACAT2 (9)
- ADH1B (9)
- ALOX5 (9)
- ANPEP (9)
- LDHA (9)
- ACY1 (8)
- CPS1 (8)
- DHRS4L2 (8)
- GAD1 (8)
- GLB1 (8)
- MCEE (8)
- OXSM (8)
- PAPSS2 (8)
- PNMT (8)
- PON3 (8)
- RPN1 (8)
- SDHB (8)
- ALDH1A3 (7)
- ALOX15 (7)
- ASS1 (7)
- CYP2A6 (7)
- CYP2E1 (7)
- DDOST (7)
- ENO2 (7)
- GBE1 (7)
- IDH1 (7)
- IDS (7)
- NNMT (7)
- POLR2A (7)
- PON1 (7)
- TALDO1 (7)
- ACADM (6)
- ACSS2 (6)
- ADH5 (6)
- ARG1 (6)
- ATP6V1C2 (6)
- BDH2 (6)
- CAT (6)
- DLD (6)
- GLUL (6)
- GPI (6)
- HSD17B4 (6)
- MPI (6)
- NANP (6)
- PGAM4 (6)
- PISD (6)
- POLR3GL (6)
- SDS (6)
- SHMT2 (6)
- TBXAS1 (6)
- TDO2 (6)
- TYR (6)
- ACO2 (5)
- AK4 (5)
- AK5 (5)
- ALDOB (5)
- ALG2 (5)
- ALOX12 (5)
- ALPI (5)
- ASL (5)
- CYP2J2 (5)
- GAPDH (5)
- GRHPR (5)
- H6PD (5)
- HSD17B10 (5)
- HSD17B8 (5)
- KYNU (5)
- NAT1 (5)
- NDUFB9 (5)
- NDUFS2 (5)
- PIKFYVE (5)
- PNLIP (5)
- PPAT (5)