Germany
Japan
United Kingdom
China
Antibodies
View as table Download
BEST4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | BEST4 antibody was raised against synthetic 15 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rabbit (93%); Hamster (87%); Pig (80%). |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Rabbit Polyclonal Anti-CLCC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLCC1 Antibody: synthetic peptide directed towards the N terminal of human CLCC1. Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW |
Rabbit Polyclonal Anti-KCNIP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL |
Rabbit Polyclonal Anti-CLIC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
Rabbit Polyclonal Anti-ACCN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN3 antibody: synthetic peptide directed towards the N terminal of human ACCN3. Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Rabbit Polyclonal Anti-CLIC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Rabbit Polyclonal Anti-CLIC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC5 antibody: synthetic peptide directed towards the C terminal of human CLIC5. Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Rabbit Polyclonal Anti-KCNH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the N terminal of human KCNH6. Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK |
Rabbit Polyclonal Anti-KCTD6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCTD6 antibody: synthetic peptide directed towards the N terminal of human KCTD6. Synthetic peptide located within the following region: HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN |
Rabbit Polyclonal Anti-CATSPER2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-CATSPER2 antibody: synthetic peptide directed towards the N terminal of human CATSPER2. Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA |
Rabbit Polyclonal Anti-KCNIP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS |
Rabbit Polyclonal Anti-CLCN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLCN3 antibody: synthetic peptide is 86% homologous to the C terminal of human CLCN3.. Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL |
Rabbit Polyclonal Anti-KCTD13 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCTD13 antibody: synthetic peptide directed towards the N terminal of human KCTD13. Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE |
Rabbit Polyclonal Anti-NUDT9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the C terminal of human NUDT9. Synthetic peptide located within the following region: LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
Rabbit Polyclonal Anti-GJB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR |
Rabbit Polyclonal Anti-GJB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
Rabbit Polyclonal Anti-GJD2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJD2 antibody: synthetic peptide directed towards the middle region of human GJD2. Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY |
KCNMB1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
CYBB (151-163) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide from an internal region of human CYBB / gp91phox (NP_000388.2) |
USD 440.00
2 Weeks
CLCN2 (738-751) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide from positions 738-751 of human CLCN2 (NP_004357.3) |
BEST4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Gorilla, Human, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | BEST4 antibody was raised against synthetic 18 amino acid peptide from internal region of human BEST4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Bat, Rabbit, Pig (100%); Marmoset, Rat, Horse (94%); Dog (89%); Panda, Lizard (83%). |
KCNE3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Immunogen | KCNE3 antibody was raised against synthetic 18 amino acid peptide from internal region of human KCNE3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Hamster (94%); Mouse, Bat (89%); Marmoset, Rat, Elephant, Panda, Dog, Bovine, Pig (83%). |
KCNE3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Immunogen | KCNE3 antibody was raised against synthetic 14 amino acid peptide from internal region of human KCNE3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum, Chicken, Platypus (100%); Marmoset, Xenopus (93%). |
KCNMB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Immunogen | KCNMB3 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (87%); Marmoset (80%). |
KCNMB3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | KCNMB3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Bovine, Bat, Horse (88%); Gibbon, Dog, Pig (82%). |
Mouse monoclonal KvBeta1.2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-KvBeta1.1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-BKBeta4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BEST3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | VMD2L3 / BEST3 antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human BEST3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Marmoset, Mouse, Rat, Hamster (89%); Monkey, Bat (83%). |
Rabbit Polyclonal Anti-BEST3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | VMD2L3 / BEST3 antibody was raised against synthetic 20 amino acid peptide from internal region of human BEST3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bat (95%); Hamster, Elephant, Panda, Bovine, Pig (90%); Dog, Rabbit (85%); Mouse, Rat, Horse, Platypus (80%). |
Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%). |
Rabbit Polyclonal Anti-GJA1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 15 amino acid peptide from internal region of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Turkey, Zebra finch, Chicken, Platypus (100%); Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum, Lizard, Xenopus (93%); Galago, Guinea pig (87%). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Families
- Ion Channels: Other
Filter by
Target Symbol
- KCTD14 (25)
- KCNAB1 (24)
- FXYD3 (15)
- AQP1 (9)
- GJA1 (9)
- CLCA1 (8)
- NUDT9 (7)
- KCTD13 (6)
- CYBB (5)
- KCTD5 (5)
- TOMM40 (5)
- VDAC1 (5)
- CLIC1 (4)
- GJB1 (4)
- CLIC5 (3)
- KCNH6 (3)
- KCNMB3 (3)
- TNFAIP1 (3)
- ABCC4 (2)
- ASIC1 (2)
- BEST3 (2)
- BEST4 (2)
- CACNA2D2 (2)
- CACNB1 (2)
- CLCA4 (2)
- CLIC4 (2)
- GJC1 (2)
- GJD2 (2)
- KCNAB2 (2)
- KCNE3 (2)
- KCNMB2 (2)
- KCNMB4 (2)
- KCTD15 (2)
- NOX1 (2)
- SCNN1A (2)
- SCNN1G (2)
- TPCN2 (2)
- VDAC2 (2)
- ASIC2 (1)
- ASIC3 (1)
- BEST1 (1)
- CACNB2 (1)
- CACNG6 (1)
- CATSPER1 (1)
- CATSPER2 (1)
- CATSPER3 (1)
- CATSPER4 (1)
- CHRFAM7A (1)
- CLCC1 (1)
- CLCN1 (1)
- CLCN2 (1)
- CLCN3 (1)
- CLCN4 (1)
- CLIC3 (1)
- CLNS1A (1)
- FXYD1 (1)
- FXYD5 (1)
- FXYD7 (1)
- GJA3 (1)
- GJA4 (1)
- GJA8 (1)
- GJB2 (1)
- GJB4 (1)
- GJB5 (1)
- GJC2 (1)
- KCNAB3 (1)
- KCNG3 (1)
- KCNH7 (1)
- KCNIP1 (1)
- KCNIP2 (1)
- KCNIP4 (1)
- KCNMB1 (1)
- KCTD6 (1)
- MLC1 (1)
- SHKBP1 (1)
- VDAC3 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (15)
- Gap junction (11)
- Olfactory transduction (10)
- Calcium signaling pathway (8)
- Huntington's disease (8)
- Parkinson's disease (8)
- Vascular smooth muscle contraction (8)
- Leukocyte transendothelial migration (7)
- Purine metabolism (7)
- Cardiac muscle contraction (6)
- Dilated cardiomyopathy (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- MAPK signaling pathway (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Taste transduction (5)
- ABC transporters (2)