Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 232 results

Page 1 of 5

(reset)

CD130 (IL6ST) Mouse Monoclonal Antibody [Clone ID: B-P4]

AM31176AF-N

USD 270.00

2 Weeks

CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free

Applications	FC, FN, IHC, IP, WB
Reactivities	Human

IL23 (IL23A) Mouse Monoclonal Antibody [Clone ID: HLT2736]

AM20386PU-N

USD 440.00

2 Weeks

IL23 (IL23A) mouse monoclonal antibody, clone HLT2736, Purified

Applications	IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

Interferon beta (IFNB1) Rabbit Polyclonal Antibody

TA306437

USD 430.00

2 Weeks

Rabbit Polyclonal IFN-beta Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Interferon gamma (IFNG) Rabbit Polyclonal Antibody

TA349348

USD 380.00

In Stock

Rabbit Polyclonal Anti-IFNG Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human IFNG

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IL20 Rabbit Polyclonal Antibody

TA349271

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDK2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CDK2

1 / 3

2 / 3

3 / 3

Previous Next

IL12A Rabbit Polyclonal Antibody

TA349020

USD 484.00

5 Days

Rabbit Polyclonal Anti-IL-12A Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A.

1 / 3

2 / 3

3 / 3

Previous Next

IL10 (Center) Rabbit Polyclonal Antibody

AP52181PU-N

USD 450.00

2 Weeks

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

1 / 3

2 / 3

3 / 3

Previous Next

IL5 Rabbit Polyclonal Antibody

AP20595PU-N

USD 370.00

2 Weeks

IL5 rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5

1 / 2

2 / 2

Previous Next

Leptin (LEP) Rabbit Polyclonal Antibody

TA328367

USD 285.00

In Stock

Anti-Human Leptin Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human Leptin

1 / 3

2 / 3

3 / 3

Previous Next

Leptin (LEP) Rabbit Polyclonal Antibody

TA346170

USD 475.00

5 Days

Rabbit Polyclonal Anti-LEP Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS

1 / 2

2 / 2

Previous Next

GM CSF (CSF2) (Center) Rabbit Polyclonal Antibody

AP51097PU-N

USD 450.00

2 Weeks

GM CSF (CSF2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 59-85 amino acids from the Central region of Human CSF2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL10 Rabbit Polyclonal Antibody

PP1032P1

USD 260.00

2 Weeks

IL10 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

1 / 3

2 / 3

3 / 3

Previous Next

EPO Rabbit Polyclonal Antibody

TA332825

USD 275.00

3 Weeks

Rabbit anti-EPO Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human EPO

Interferon beta (IFNB1) Rabbit Polyclonal Antibody

PP1230P1

USD 260.00

2 Weeks

Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly purified (>98%) E.coli derived recombinant Human Inferferon beta.

1 / 3

2 / 3

3 / 3

Previous Next

IL9R Rabbit Polyclonal Antibody

TA314076

USD 345.00

In Stock

Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

IL23 (IL23A) Rabbit Polyclonal Antibody

TA317846

USD 525.00

In Stock

IL-23 p19 Rabbit Polyclonal (C-Terminus) Antibody

Applications	IHC
Reactivities	Tested:
Conjugation	Unconjugated
Immunogen	IL23A / IL-23 p19 antibody was raised against synthetic peptide from human IL23A / IL-23.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL4R Rabbit Polyclonal Antibody

AP20570PU-N

USD 370.00

2 Weeks

IL4R rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 220-265 of Human IL-4Rα.

1 / 3

2 / 3

3 / 3

Previous Next

Leptin (LEP) (N-term) Rabbit Polyclonal Antibody

AP52465PU-N

USD 450.00

2 Weeks

Leptin (LEP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 7-37 amino acids from the N-terminal region of Human Leptin.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IL6 Goat Polyclonal Antibody

PP1028P1

USD 260.00

2 Weeks

IL6 goat polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

IL6 Goat Polyclonal Antibody

PP1028P2

USD 355.00

2 Weeks

IL6 goat polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

IL21 Rabbit Polyclonal Antibody

TA317844

USD 525.00

5 Days

IL-21 Rabbit Polyclonal (Internal) Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .

IL22 Rabbit Polyclonal Antibody

TA326688

USD 430.00

5 Days

Rabbit Polyclonal IL-22 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	IL-22 antibody was raised against a 17 amino acid peptide near the center of human IL-22

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL5 Rabbit Polyclonal Antibody

TA328213

USD 285.00

5 Days

Anti-Human IL-5 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IL-5

1 / 3

2 / 3

3 / 3

Previous Next

G CSF (CSF3) Rabbit Polyclonal Antibody

TA328322

USD 285.00

5 Days

Anti-Human G-CSF Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human G-CSF

1 / 3

2 / 3

3 / 3

Previous Next

IL22 Mouse Monoclonal Antibody [Clone ID: 8F11E2]

TA337159

USD 424.00

5 Days

Mouse Monoclonal IL-22 Antibody (8F11E2)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

IL23 (IL23A) Mouse Monoclonal Antibody [Clone ID: B-Z23]

AM31213AF-N

USD 470.00

2 Weeks

IL23 (IL23A) mouse monoclonal antibody, clone B-Z23, Azide Free

Applications	FN, IHC
Reactivities	Human

Leptin Receptor (LEPR) Rabbit Polyclonal Antibody

AP20585PU-N

USD 407.00

2 Weeks

Leptin Receptor (LEPR) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

Leptin Receptor (LEPR) (829-841) Goat Polyclonal Antibody

AP22503PU-N

USD 440.00

2 Weeks

Leptin Receptor (LEPR) (829-841) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide C-TQDDIEKHQSDAG from an internal region of human LEPR / Leptin Receptor (NP_002294.2; NP_001003679.1; NP_001003680.1).  Epitope: aa829-841

1 / 3

2 / 3

3 / 3

Previous Next

IL6 (Center) Rabbit Polyclonal Antibody

AP52199PU-N

USD 450.00

2 Weeks

IL6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 26-55 amino acids from the Central region of Human Interleukin-6

1 / 3

2 / 3

3 / 3

Previous Next

IL4 Rabbit Polyclonal Antibody

PP1026P2

USD 355.00

2 Weeks

IL4 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) recombinant hIL-4 (human IL-4)

IL10 Rabbit Polyclonal Antibody

PP1032P2

USD 355.00

2 Weeks

IL10 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) E.coli derived recombinant Human IL-10 (Cat.-No PA084)

1 / 3

2 / 3

3 / 3

Previous Next

Interferon beta (IFNB1) Rabbit Polyclonal Antibody

PP1230P2

USD 355.00

2 Weeks

Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly purified (>98%) E.coli derived recombinant Human Inferferon beta.

1 / 3

2 / 3

3 / 3

Previous Next

IL23 (IL23A) Rabbit Polyclonal Antibody

TA317789

USD 425.00

In Stock

IL-23 p19 Rabbit Polyclonal (N-Terminus) Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	IL23A / IL-23 p19 antibody was raised against synthetic peptide from human IL23A / IL-23.

1 / 2

2 / 2

Previous Next

IL15 Rabbit Polyclonal Antibody

TA319665

USD 430.00

5 Days

Rabbit Polyclonal IL-15 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Rabbit polyclonal IL-15 antibody was raised against a 13 amino acid peptide near the center of human IL-15.

1 / 2

2 / 2

Previous Next

IL9 Rabbit Polyclonal Antibody

TA326661

USD 430.00

5 Days

Rabbit Polyclonal IL-9 Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9.

1 / 3

2 / 3

3 / 3

Previous Next

IL4 Rabbit Polyclonal Antibody

TA328211

USD 285.00

5 Days

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IL-4

1 / 3

2 / 3

3 / 3

Previous Next

IL6 Rabbit Polyclonal Antibody

TA328217

USD 285.00

5 Days

Anti-Human IL-6 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IL-6

1 / 3

2 / 3

3 / 3

Previous Next

IL10 Rabbit Polyclonal Antibody

TA328225

USD 285.00

5 Days

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IL-10

1 / 3

2 / 3

3 / 3

Previous Next

Leptin (LEP) Rabbit Polyclonal Antibody

TA332832

USD 275.00

3 Weeks

Rabbit anti-LEP Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant protein of human LEP

LIF Rat Monoclonal Antibody [Clone ID: 39N7D10]

TA337172

USD 424.00

5 Days

Rat Monoclonal LIF Antibody (39N7D10)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

IL10 Mouse Monoclonal Antibody [Clone ID: BN-10]

AM39036FC-N

USD 540.00

2 Weeks

IL10 mouse monoclonal antibody, clone BN-10, FITC

Applications	FC, IHC
Reactivities	Human
Conjugation	FITC

IL23 (IL23A) (C-term) Rabbit Polyclonal Antibody

AP05588PU-N

USD 515.00

5 Days

IL23 (IL23A) (C-term) rabbit polyclonal antibody, Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Immunogen	A 14 amino acid peptide from near the carboxy-terminus of human IL-23

1 / 2

2 / 2

Previous Next

IL23 (IL23A) (N-term) Rabbit Polyclonal Antibody

AP05589PU-N

USD 425.00

5 Days

IL23 (IL23A) (N-term) rabbit polyclonal antibody, Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Immunogen	A 16 amino acid peptide from near the amino terminus of human IL-23.

1 / 2

2 / 2

Previous Next

Interferon gamma (IFNG) Rabbit Polyclonal Antibody

AP20609PU-N

USD 370.00

2 Weeks

Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ.

1 / 2

2 / 2

Previous Next

IL12A Rabbit Polyclonal Antibody

AP20613PU-N

USD 370.00

2 Weeks

IL12A rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat

1 / 2

2 / 2

Previous Next

CD130 (IL6ST) (C-term) Rabbit Polyclonal Antibody

AP50838PU-N

USD 450.00

2 Weeks

CD130 (IL6ST) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 878-906 amino acids from the C-terminal region of human CD130

1 / 2

2 / 2

Previous Next

GCSF Receptor (CSF3R) (Center) Rabbit Polyclonal Antibody

AP51098PU-N

USD 450.00

2 Weeks

GCSF Receptor (CSF3R) (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 252~280 amino acids from the Center region of human CSF3R

1 / 3

2 / 3

3 / 3

Previous Next

IL12B (C-term) Rabbit Polyclonal Antibody

AP52183PU-N

USD 450.00

2 Weeks

IL12B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B.

1 / 3

2 / 3

3 / 3

Previous Next

IL4 Rabbit Polyclonal Antibody

PP1026P1

USD 260.00

2 Weeks

IL4 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) recombinant hIL-4 (human IL-4)

Leptin Receptor (LEPR) Goat Polyclonal Antibody

TA302673

USD 375.00

2 Weeks

Goat Polyclonal Antibody against Leptin Receptor

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-TQDDIEKHQSDAG, from the internal region of the protein sequence according to NP_002294.2; NP_001003679.1; NP_001003680.1.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 50 of 232 results

Page 1 of 5