Germany
Japan
United Kingdom
China
TIA1 mouse monoclonal antibody, clone 2G9A10F5, Purified
| Applications | IHC |
| Reactivities | Human |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit Polyclonal Anti-MSH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Wilms Tumor Protein (WT1) mouse monoclonal antibody, clone 6F-H2, Supernatant
| Applications | IHC |
| Reactivities | Human |
MLH1 mouse monoclonal antibody, clone n.a, Ascites
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
USD 570.00
5 Days
Thymidylate Synthase (TYMS) mouse monoclonal antibody, clone TS106, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
USD 375.00
5 Days
Tartrate Resistant Acid Phosphatase (ACP5) mouse monoclonal antibody, clone 9C5, Supernatant
| Applications | IHC |
| Reactivities | Human |
PCNA mouse monoclonal antibody, clone IML-83, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
SFTPB mouse monoclonal antibody, clone 1B9, Supernatant
| Applications | IF, IHC |
| Reactivities | Human |
Villin (VIL1) mouse monoclonal antibody, clone CWWB1, Supernatant
| Applications | IHC |
| Reactivities | Human |
TPSAB1 mouse monoclonal antibody, clone G3, Supernatant
| Applications | IHC |
| Reactivities | Human |
PMS2 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RFC5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE |
USD 290.00
5 Days
Prostatic Acid Phosphatase (ACPP) mouse monoclonal antibody, clone PASE/4LJ, Supernatant
| Applications | IHC |
| Reactivities | Human |
PTEN mouse monoclonal antibody, clone 6H2.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
ZAP70 mouse monoclonal antibody, clone 2F3.2, Supernatant
| Applications | IHC |
| Reactivities | Human |
Rabbit polyclonal PMS2/PMS2CL antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PMS2/PMS2CL. |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
