Germany
Japan
United Kingdom
China
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Antibodies
View as table Download
Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
Rabbit Polyclonal Anti-ACSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit Polyclonal Anti-ACAA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-SCD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
Rabbit Polyclonal Anti-CPT1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
SCD1 (SCD) mouse monoclonal antibody, clone CD.E10, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse |
Rabbit anti-ILK Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ILK |
Rabbit anti-PDPK1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human PDPK1 |
USD 440.00
2 Weeks
Apolipoprotein CIII (APOC3) (N-term) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | APOC3 Recombinant protein from the N-terminus |
Rabbit polyclonal antibody to ME1 (malic enzyme 1, NADP(+)-dependent, cytosolic)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 161 and 519 of (Uniprot ID#P48163) |
Rabbit polyclonal SCP2 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2. |
USD 480.00
2 Weeks
USD 480.00
2 Weeks
SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Immunogen | Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3. |
Active filters
Filter by
Target Symbol
- ADIPOQ (81)
- LPL (35)
- ACADM (17)
- CPT1B (14)
- CD36 (13)
- SCP2 (12)
- PPARD (10)
- FABP2 (9)
- MMP1 (8)
- EHHADH (7)
- NR1H3 (7)
- PLIN1 (7)
- ACAA1 (6)
- ACSL5 (6)
- APOA5 (6)
- FABP7 (6)
- PPARA (6)
- PPARG (6)
- APOA1 (5)
- CPT1A (5)
- ILK (5)
- ME1 (5)
- SCD (5)
- ANGPTL4 (4)
- FABP3 (4)
- FABP4 (4)
- PCK1 (4)
- PDPK1 (4)
- ACOX3 (3)
- APOA2 (3)
- CYP4A11 (3)
- CYP8B1 (3)
- FABP1 (3)
- OLR1 (3)
- ACOX1 (2)
- ACOX2 (2)
- ACSL1 (2)
- ACSL4 (2)
- CYP27A1 (2)
- DBI (2)
- FABP6 (2)
- GK (2)
- RXRG (2)
- SLC27A1 (2)
- SLC27A2 (2)
- SLC27A5 (2)
- UBC (2)
- UCP1 (2)
- ACSL3 (1)
- APOC3 (1)
- AQP7 (1)
- CPT2 (1)
- CYP4A22 (1)
- CYP7A1 (1)
- FADS2 (1)
- GK2 (1)
- HMGCS2 (1)
- PCK2 (1)
- PLTP (1)
- SLC27A6 (1)
- SORBS1 (1)