Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
GFAP chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Recombinant Human GFAP (expressed in bacteria). After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
USD 220.00
2 Weeks
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Germany
Japan
United Kingdom
China
