Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
.jpg?d=110x100 "User supplied image")
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 379.00
In Stock
USD 428.00
In Stock
USD 379.00
In Stock
USD 428.00
In Stock
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Active filters
Reactivities
- Rat
Applications
- IHC
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- MAP2K1 (105)
- NME1 (84)
- OTC (71)
- ERBB2 (67)
- MAP2K3 (58)
- ABCB1 (51)
- AKT1 (48)
- CTNNB1 (47)
- PCNA (47)
- VSNL1 (46)
- JUN (43)
- TOP2A (43)
- PIK3C2A (42)
- APP (40)
- NCAM1 (37)
- SENP2 (37)
- ABAT (36)
- HSPD1 (34)
- LOX (34)
- BCL2 (32)
- AKR1A1 (31)
- F13A1 (31)
- LTA4H (31)
- MCM2 (31)
- NPR3 (31)
- PFKP (31)
- PPP5C (31)
- ALDH1L1 (30)
- PDE4A (30)
- PIK3CG (30)
- TYMS (30)
- UBE2G2 (30)
- GCH1 (29)
- MMP13 (29)
- MTOR (29)
- PTPRE (29)
- RET (29)
- SQSTM1 (29)
- BTK (28)
- ESR1 (28)
- FOS (28)
- L1CAM (28)
- NR3C1 (28)
- STAT4 (28)
- ACAT2 (27)
- DEF6 (27)
- POR (27)
- UNG (27)
- ERG (25)
- RAB21 (25)
- SNAP25 (25)
- GLI1 (24)
- PRKAR2A (24)
- RHOJ (24)
- TNNT2 (24)
- UPRT (24)
- EGFR (23)
- RPA2 (23)
- RRM1 (23)
- BCL10 (22)
- ID3 (22)
- NKX2-1 (22)
- TH (22)
- USP7 (22)
- CHEK2 (21)
- CMPK1 (21)
- GPR17 (21)
- LPL (21)
- NRBP1 (21)
- PIK3R5 (21)
- PIM2 (21)
- PSMA6 (21)
- PSMB9 (21)
- RFXANK (21)
- RGS16 (21)
- SATB1 (21)
- SNX9 (21)
- TLK2 (21)
- TRMT2A (21)
- CTNND1 (20)
- KRT8 (20)
- PRKCE (20)
- STAT5A (20)
- CLOCK (19)
- FMR1 (19)
- MAPK1 (19)
- MLH1 (19)
- MME (19)
- NEUROG1 (19)
- SKIL (19)
- TNNI3 (19)
- BECN1 (18)
- CPM (18)
- DES (18)
- GBA (18)
- GBE1 (18)
- GPI (18)
- MAP2K4 (18)
- NR2C2 (18)
- NRBF2 (18)
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (1458)
- Metabolic pathways (1310)
- Focal adhesion (901)
- MAPK signaling pathway (863)
- Prostate cancer (754)
- Colorectal cancer (725)
- ErbB signaling pathway (715)
- Neurotrophin signaling pathway (708)
- Insulin signaling pathway (615)
- Regulation of actin cytoskeleton (602)
- Toll-like receptor signaling pathway (598)
- Pancreatic cancer (589)
- Endometrial cancer (585)
- T cell receptor signaling pathway (578)
- Chemokine signaling pathway (567)
- Progesterone-mediated oocyte maturation (539)
- B cell receptor signaling pathway (533)
- Chronic myeloid leukemia (532)
- Fc epsilon RI signaling pathway (525)
- Renal cell carcinoma (525)
- Acute myeloid leukemia (522)
- Non-small cell lung cancer (507)
- Glioma (495)
- Melanoma (481)
- GnRH signaling pathway (446)
- Fc gamma R-mediated phagocytosis (426)
- VEGF signaling pathway (420)
- Apoptosis (406)
- Bladder cancer (380)
- Small cell lung cancer (380)
- Natural killer cell mediated cytotoxicity (371)
- Wnt signaling pathway (359)
- Gap junction (357)
- Jak-STAT signaling pathway (357)
- Adherens junction (334)
- Leukocyte transendothelial migration (328)
- Melanogenesis (327)
- Cell cycle (325)
- Calcium signaling pathway (314)
- Oocyte meiosis (314)
- Neuroactive ligand-receptor interaction (311)
- Thyroid cancer (296)
- Adipocytokine signaling pathway (295)
- Purine metabolism (295)
- Vascular smooth muscle contraction (285)
- Alzheimer's disease (284)
- mTOR signaling pathway (283)
- Long-term potentiation (275)
- Type II diabetes mellitus (267)
- Endocytosis (261)
- Cytokine-cytokine receptor interaction (259)
- Long-term depression (257)
- Amyotrophic lateral sclerosis (ALS) (256)
- Tight junction (246)
- Epithelial cell signaling in Helicobacter pylori infection (232)
- Pyrimidine metabolism (225)
- Prion diseases (221)
- Axon guidance (220)
- TGF-beta signaling pathway (209)
- Glycolysis / Gluconeogenesis (203)
- Phosphatidylinositol signaling system (184)
- Dorso-ventral axis formation (180)
- Huntington's disease (175)
- p53 signaling pathway (172)
- Pathogenic Escherichia coli infection (162)
- NOD-like receptor signaling pathway (157)
- Basal cell carcinoma (156)
- Ubiquitin mediated proteolysis (154)
- Cell adhesion molecules (CAMs) (153)
- Arginine and proline metabolism (148)
- Inositol phosphate metabolism (147)
- Parkinson's disease (142)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (140)
- Dilated cardiomyopathy (138)
- Valine (135)
- DNA replication (133)
- Base excision repair (132)
- leucine and isoleucine degradation (132)
- Mismatch repair (129)
- Hypertrophic cardiomyopathy (HCM) (128)
- Nucleotide excision repair (122)
- RIG-I-like receptor signaling pathway (121)
- Butanoate metabolism (115)
- ABC transporters (110)
- Alanine (108)
- aspartate and glutamate metabolism (108)
- Hedgehog signaling pathway (101)
- Primary immunodeficiency (101)
- Propanoate metabolism (99)
- PPAR signaling pathway (97)
- Fatty acid metabolism (95)
- Proteasome (93)
- Drug metabolism - cytochrome P450 (91)
- Pyruvate metabolism (91)
- Arachidonic acid metabolism (85)
- Notch signaling pathway (84)
- Tyrosine metabolism (83)
- Antigen processing and presentation (82)
- Hematopoietic cell lineage (82)
- Glycerolipid metabolism (80)
- Complement and coagulation cascades (78)
- ECM-receptor interaction (77)
- Pentose phosphate pathway (76)
- Metabolism of xenobiotics by cytochrome P450 (74)
- beta-Alanine metabolism (73)
- Tryptophan metabolism (71)
- Type I diabetes mellitus (71)
- One carbon pool by folate (68)
- Lysosome (64)
- Cardiac muscle contraction (63)
- Fructose and mannose metabolism (63)
- Starch and sucrose metabolism (63)
- Retinol metabolism (62)
- Vibrio cholerae infection (60)
- Renin-angiotensin system (58)
- Viral myocarditis (57)
- Glutathione metabolism (56)
- Cytosolic DNA-sensing pathway (54)
- Galactose metabolism (54)
- Histidine metabolism (54)
- Citrate cycle (TCA cycle) (51)
- Lysine degradation (49)
- RNA degradation (45)
- Folate biosynthesis (44)
- Regulation of autophagy (43)
- Maturity onset diabetes of the young (41)
- SNARE interactions in vesicular transport (41)
- Synthesis and degradation of ketone bodies (40)
- Amino sugar and nucleotide sugar metabolism (39)
- Oxidative phosphorylation (39)
- Spliceosome (39)
- Circadian rhythm - mammal (38)
- Homologous recombination (37)
- Glycine (36)
- serine and threonine metabolism (36)
- Phenylalanine metabolism (30)
- Terpenoid backbone biosynthesis (30)
- Olfactory transduction (29)
- Sphingolipid metabolism (29)
- Taste transduction (28)
- Drug metabolism - other enzymes (27)
- Methane metabolism (25)
- Ribosome (25)
- Nitrogen metabolism (20)
- Other glycan degradation (20)
- Systemic lupus erythematosus (20)
- Cysteine and methionine metabolism (19)
- Sulfur metabolism (19)
- Androgen and estrogen metabolism (18)
- Fatty acid biosynthesis (18)
- Glyoxylate and dicarboxylate metabolism (18)
- Porphyrin and chlorophyll metabolism (18)
- Graft-versus-host disease (17)
- Non-homologous end-joining (17)
- Allograft rejection (16)
- Autoimmune thyroid disease (16)
- Caffeine metabolism (16)
- Ascorbate and aldarate metabolism (15)
- Selenoamino acid metabolism (15)
- Taurine and hypotaurine metabolism (15)
- Primary bile acid biosynthesis (14)
- Glycerophospholipid metabolism (13)
- Limonene and pinene degradation (13)
- Linoleic acid metabolism (13)
- Ether lipid metabolism (11)
- Pantothenate and CoA biosynthesis (11)
- Nicotinate and nicotinamide metabolism (10)
- Vitamin B6 metabolism (9)
- Glycosaminoglycan degradation (8)
- Steroid biosynthesis (7)
- Biosynthesis of unsaturated fatty acids (6)
- Fatty acid elongation in mitochondria (6)
- Pentose and glucuronate interconversions (6)
- Aminoacyl-tRNA biosynthesis (5)
- Riboflavin metabolism (5)
- Asthma (4)
- Basal transcription factors (4)
- C21-Steroid hormone metabolism (4)
- leucine and isoleucine biosynthesis (4)
- D-Glutamine and D-glutamate metabolism (3)
- Protein export (3)
- Glycosphingolipid biosynthesis - globo series (2)
- O-Glycan biosynthesis (2)
- alpha-Linolenic acid metabolism (2)
- Chondroitin sulfate biosynthesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- N-Glycan biosynthesis (1)
- Phenylalanine (1)
- RNA polymerase (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)