Germany
Japan
United Kingdom
China
USD 250.00
2 Weeks
Antibodies
View as table Download
Tubulin (TUBA1B) (Tyr-Tubulin) rat monoclonal antibody, clone YL1/2, Purified
| Applications | ELISA, IF, IHC, IP, R, WB |
| Reactivities | Birds, Mammalian, Yeast |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the N terminal of human NCL. Synthetic peptide located within the following region: GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the C terminal of human NCL. Synthetic peptide located within the following region: GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
USD 340.00
2 Weeks
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to beta Tubulin (tubulin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 238 and 429 of beta Tubulin |
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
USD 340.00
2 Weeks
Rabbit polyclonal anti-TUBA4A(alpha Tubulin) antibody, Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 243 of alpha Tubulin 4a (Uniprot ID#P68366) |
Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 300 of ARPC2 (Uniprot ID#O15144) |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-ABL1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABL1 |
Tubulin (TUBA1B) mouse monoclonal antibody, clone TU-16, Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Porcine |
USD 230.00
2 Weeks
USD 230.00
2 Weeks
Tubulin (TUBA1B) mouse monoclonal antibody, clone TU-16, Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | All Species |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Pathways
- Pathogenic Escherichia coli infection
Filter by
Target Symbol
- CTNNB1 (83)
- KRT18 (59)
- CDH1 (52)
- TUBAL3 (35)
- CD14 (30)
- TUBB2B (20)
- TUBB4A (20)
- SHC1 (16)
- TUBA1A (14)
- TUBA1B (13)
- ABL1 (12)
- WASL (11)
- TLR4 (10)
- TUBA8 (10)
- ACTB (9)
- PRKCA (9)
- TUBB1 (8)
- CLDN1 (7)
- CTTN (7)
- NCF1 (7)
- ROCK2 (7)
- ITGB1 (6)
- TUBB (6)
- YWHAQ (6)
- YWHAZ (6)
- ARPC5 (5)
- LY96 (5)
- TLR5 (5)
- TUBA4A (5)
- TUBB2A (5)
- FYN (4)
- NCL (4)
- ROCK1 (4)
- TUBB3 (4)
- EZR (3)
- HCLS1 (3)
- TUBA1C (3)
- ACTG1 (2)
- ARHGEF2 (2)
- ARPC2 (2)
- NCK1 (2)
- NCK2 (2)
- RHOA (2)
- TUBA3C (2)
- ARPC1A (1)
- ARPC3 (1)
- ARPC4 (1)
- CDC42 (1)
- TUBB8 (1)
- WAS (1)
Reactivities
- Human (440)
- Mouse (307)
- Rat (278)
- Monkey (89)
- Dog (78)
- Bovine (15)
- Chicken (7)
- Pig (6)
- Rhesus Monkey (6)
- Xenopus (5)
- Chimpanzee (4)
- Porcine (4)
- Canine (3)
- All Species (2)
- Guinea Pig (2)
- Hamster (2)
- Primate (2)
- Rabbit (2)
- Sheep (2)
- Avian (1)
- Bat (1)
- Cow (1)
- Drosophila (1)
- Fish (1)
- Horse (1)
- Mammalian (1)
- Squirrel (1)
- X. tropicalis (1)
- Yeast (1)
- Zebrafish (1)