Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal Anti-OAT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
GNAT3 / Gustducin Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GNAT3 / Gustducin antibody was raised against synthetic peptide C-KNQFLDLNLKKEDKE from an internal region of human GNAT3 (NP_001095856.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Bat, Lizard (93%); Platypus (87%); Turkey, Chicken (80%). |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
FSP1 / S100A4 Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | S100A4 / FSP1 antibody was raised against synthetic peptide CNEFFEGFPDKQP from the C-terminus of human S100A4 / FSP1 (NP_002952.1; NP_062427.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Elephant, Bat (92%); Mouse, Rat (85%). |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TGFBI Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TGFBI antibody was raised against synthetic peptide C-QLYTDRTEKLRPE from an internal region of human TGFBI (NP_000349.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Platypus (92%). |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-DEFB129 Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DEFB129 antibody is: synthetic peptide directed towards the C-terminal region of Human DEFB129. Synthetic peptide located within the following region: TSFFANTNFVIIPNATPMNSATISTMTPGQITYTATSTKSNTKESRDSAT |
Goat Polyclonal Anti-PRDM1 / MEL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRDM1 / MEL1 Antibody: Peptide with sequence C-DISDNADRLEDVED, from the internal region of the protein sequence according to NP_001189.2; NP_878911.1. |
Rabbit Polyclonal Antibody against MEF2C (S387)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEF2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-394 amino acids from human MEF2C. |
Goat Polyclonal Antibody against DLC1 (Isoforms 1 and 3)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SVAIRKRSWEEHC, from the N Terminus of the protein sequence according to NP_872584.1; NP_079043.2. |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 223 and 502 of O-GlcNAc transferase (Uniprot ID#O15294) |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 300 of ARPC2 (Uniprot ID#O15144) |
Active filters
Reactivities
- Pig
Applications
- IHC
Filter by
Category
Target Symbol
- GPR4 (3)
- MEF2C (3)
- SMAD3 (3)
- ACTA1 (2)
- AIF1 (2)
- ALB (2)
- APEX1 (2)
- CD3E (2)
- FTCD (2)
- GAD2 (2)
- GAPDH (2)
- GLG1 (2)
- GNAS (2)
- GRPR (2)
- H2AFZ (2)
- HCRTR1 (2)
- HPRT1 (2)
- HSPD1 (2)
- INSR (2)
- JUP (2)
- KCNJ6 (2)
- KCNMA1 (2)
- NQO1 (2)
- NR5A1 (2)
- OGT (2)
- PON2 (2)
- PTGES (2)
- SLC39A14 (2)
- SNAP25 (2)
- STK26 (2)
- SYNTAXIN (2)
- TM9SF3 (2)
- TP53 (2)
- WNT4 (2)
- AAPK1 (1)
- ACAP2 (1)
- ACO2 (1)
- ACTC1 (1)
- ACY1 (1)
- ADAM19 (1)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ADAP1 (1)
- ADCYAP1R1 (1)
- ADGRF5 (1)
- ADGRG1 (1)
- ADRA1A (1)
- ADRA1B (1)
- AGTR2 (1)
- AIRE (1)
- AKR1A1 (1)
- ALDH6A1 (1)
- AMPH (1)
- ANK3 (1)
- ANP32B (1)
- ANXA1 (1)
- APH1A (1)
- APP (1)
- AR (1)
- ARAF (1)
- ARF3 (1)
- ARF5 (1)
- ARPC2 (1)
- ASPA (1)
- ATG5 (1)
- ATIC (1)
- ATP1B3 (1)
- ATP4A (1)
- ATXN3 (1)
- AVPR1B (1)
- BEST2 (1)
- BEST4 (1)
- BHMT (1)
- BIVM (1)
- C5 (1)
- CALB2 (1)
- CALCRL (1)
- CAPZB (1)
- CAV2 (1)
- CAV3 (1)
- CCT2 (1)
- CFL2 (1)
- CHFR (1)
- CHMP5 (1)
- CHRM3 (1)
- CHRNB2 (1)
- CKB (1)
- CLTC (1)
- CNTN1 (1)
- COX5B (1)
- CPS1 (1)
- CS (1)
- CSE1L (1)
- CTSK (1)
- CXCR5 (1)
- DCDC2 (1)
- DEFB129 (1)
- DES (1)
- DIO2 (1)
- DLC1 (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
- Phospho-specific (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (232)
- Transmembrane (105)
- Transcription Factors (47)
- GPCR (34)
- Secreted Protein (32)
- ES Cell Differentiation/IPS (24)
- Stem cell - Pluripotency (20)
- Protease (16)
- Protein Kinase (11)
- Stem cell relevant signaling - JAK/STAT signaling pathway (7)
- Adult stem cells (6)
- Ion Channels: Potassium (6)
- Nuclear Hormone Receptor (6)
- Cancer stem cells (5)
- Embryonic stem cells (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)
- Ion Channels: Transient receptor potential (3)
- Stem cell relevant signaling - Wnt Signaling pathway (3)
- Phosphatase (2)
- Induced pluripotent stem cells (1)
- Ion Channels: Cys-loop Receptors (1)
- Ion Channels: Other (1)
- Ion Channels: Sodium (1)
Pathways
- Metabolic pathways (49)
- Pathways in cancer (31)
- Neuroactive ligand-receptor interaction (24)
- Wnt signaling pathway (19)
- MAPK signaling pathway (14)
- Calcium signaling pathway (11)
- Colorectal cancer (11)
- Melanogenesis (11)
- Vascular smooth muscle contraction (11)
- Basal cell carcinoma (10)
- Chronic myeloid leukemia (10)
- Insulin signaling pathway (10)
- Pancreatic cancer (10)
- Prostate cancer (10)
- Regulation of actin cytoskeleton (9)
- Acute myeloid leukemia (8)
- Adherens junction (8)
- Arginine and proline metabolism (8)
- Cell cycle (8)
- Endocytosis (8)
- Hedgehog signaling pathway (8)
- Huntington's disease (8)
- Alzheimer's disease (7)
- Chemokine signaling pathway (7)
- ErbB signaling pathway (7)
- Focal adhesion (7)
- Gap junction (7)
- Long-term depression (7)
- Progesterone-mediated oocyte maturation (7)
- TGF-beta signaling pathway (7)
- Alanine (6)
- Arachidonic acid metabolism (6)
- Bladder cancer (6)
- Endometrial cancer (6)
- Fc gamma R-mediated phagocytosis (6)
- GnRH signaling pathway (6)
- Lysosome (6)
- Melanoma (6)
- Pathogenic Escherichia coli infection (6)
- Purine metabolism (6)
- aspartate and glutamate metabolism (6)
- Axon guidance (5)
- B cell receptor signaling pathway (5)
- Dilated cardiomyopathy (5)
- Fc epsilon RI signaling pathway (5)
- Glioma (5)
- Glycolysis / Gluconeogenesis (5)
- Jak-STAT signaling pathway (5)
- Natural killer cell mediated cytotoxicity (5)
- Neurotrophin signaling pathway (5)
- Non-small cell lung cancer (5)
- Oocyte meiosis (5)
- Parkinson's disease (5)
- Type I diabetes mellitus (5)
- Amyotrophic lateral sclerosis (ALS) (4)
- Citrate cycle (TCA cycle) (4)
- Glutathione metabolism (4)
- Glycerolipid metabolism (4)
- Histidine metabolism (4)
- Hypertrophic cardiomyopathy (HCM) (4)
- Maturity onset diabetes of the young (4)
- One carbon pool by folate (4)
- Regulation of autophagy (4)
- Renal cell carcinoma (4)
- Systemic lupus erythematosus (4)
- T cell receptor signaling pathway (4)
- Taste transduction (4)
- Thyroid cancer (4)
- p53 signaling pathway (4)
- Adipocytokine signaling pathway (3)
- Amino sugar and nucleotide sugar metabolism (3)
- Antigen processing and presentation (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Base excision repair (3)
- Cardiac muscle contraction (3)
- Cell adhesion molecules (CAMs) (3)
- Cysteine and methionine metabolism (3)
- Inositol phosphate metabolism (3)
- Oxidative phosphorylation (3)
- Phenylalanine metabolism (3)
- Prion diseases (3)
- Proteasome (3)
- Ribosome (3)
- Small cell lung cancer (3)
- Spliceosome (3)
- Tight junction (3)
- Toll-like receptor signaling pathway (3)
- Type II diabetes mellitus (3)
- Tyrosine metabolism (3)
- Ubiquitin mediated proteolysis (3)
- VEGF signaling pathway (3)
- Vibrio cholerae infection (3)
- mTOR signaling pathway (3)
- Apoptosis (2)
- Butanoate metabolism (2)
- Complement and coagulation cascades (2)
- Cytokine-cytokine receptor interaction (2)
- Drug metabolism - cytochrome P450 (2)
- Drug metabolism - other enzymes (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Fructose and mannose metabolism (2)
- Glycerophospholipid metabolism (2)
- Glycine (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Leukocyte transendothelial migration (2)
- Long-term potentiation (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- NOD-like receptor signaling pathway (2)
- Nitrogen metabolism (2)
- Notch signaling pathway (2)
- O-Glycan biosynthesis (2)
- PPAR signaling pathway (2)
- Phosphatidylinositol signaling system (2)
- Primary immunodeficiency (2)
- Propanoate metabolism (2)
- RNA degradation (2)
- Renin-angiotensin system (2)
- Starch and sucrose metabolism (2)
- Taurine and hypotaurine metabolism (2)
- Valine (2)
- Viral myocarditis (2)
- beta-Alanine metabolism (2)
- leucine and isoleucine degradation (2)
- serine and threonine metabolism (2)
- Autoimmune thyroid disease (1)
- D-Glutamine and D-glutamate metabolism (1)
- Dorso-ventral axis formation (1)
- Ether lipid metabolism (1)
- Fatty acid biosynthesis (1)
- Galactose metabolism (1)
- Glycosaminoglycan degradation (1)
- Limonene and pinene degradation (1)
- Linoleic acid metabolism (1)
- Lysine degradation (1)
- N-Glycan biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- Other glycan degradation (1)
- Pantothenate and CoA biosynthesis (1)
- Phenylalanine (1)
- Pyruvate metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Riboflavin metabolism (1)
- Sphingolipid metabolism (1)
- Sulfur metabolism (1)
- Tryptophan metabolism (1)
- alpha-Linolenic acid metabolism (1)
- tyrosine and tryptophan biosynthesis (1)