Peroxidase Conjugated Affinity Purified Goat anti-Mouse IgG [H&L]
Applications | WB: 1: 1,000; ICC: 1:200; IP: 1:200 |
Reactivities | Mouse IgG |
Conjugation | HRP |
Immunogen | Mouse IgG, whole molecule |
Peroxidase Conjugated Affinity Purified Goat anti-Mouse IgG [H&L]
Applications | WB: 1: 1,000; ICC: 1:200; IP: 1:200 |
Reactivities | Mouse IgG |
Conjugation | HRP |
Immunogen | Mouse IgG, whole molecule |
Anti-DDK (FLAG) rabbit polyclonal antibody
Applications | IP, WB |
Immunogen | A synthetic peptide (DYKDDDDK) coupled to KLH |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Immunogen | Collagen type I purified from Human and Bovine placenta. |
Rabbit polyclonal eGFP antibody
Applications | IF, IP, WB |
Immunogen | Recombinant full length protein of eGFP (1-265aa) |
Anti-HA tag rabbit polyclonal antibody
Applications | IF, IP, WB |
Immunogen | Synthetic peptide contain a sequence corresponding to a region of HA Tag |
GFP rabbit polyclonal antibody
Applications | ELISA, IP, WB |
Reactivities | A. victoria |
Immunogen | E.coli expressed full-length GFP (Green Fluorescent Protein). |
Anti-6X His tag rabbit polyclonal antibody
Applications | ELISA, IP, WB |
Immunogen | Rabbit Polyclonal antibody to 6X His tag |
Rabbit polyclonal antibody to CACNA1B (calcium channel, voltage-dependent, N type, alpha 1B subunit)
Applications | IF, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2013 and 2209 of CACNA1B (Uniprot ID#Q00975) |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mouse, Rat, Sheep |
Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Immunogen | Collagen type I purified from Human and Bovine placenta. |
GFP rabbit polyclonal antibody, Purified
Applications | IF, IP, WB |
Reactivities | All Species |
Immunogen | EGFP, a native full-length protein |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Conjugation | Biotin |
Immunogen | Collagen Type I from Human and Bovine placenta. |
PGK1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bakers Yeast |
Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit anti-IRF3 Polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF3 |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Thermolysin rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bacillus sp. |
Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
OVAL rabbit polyclonal antibody, Biotin, Purified
Applications | ELISA, IP, WB |
Reactivities | Chicken |
Conjugation | Biotin |
Immunogen | Native Ovalbumin from hen egg white |
Osteopontin (SPP1) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IHC, IP, WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide corresponding to Human Osteopontin conjugated to KLH using maleimide. |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
Rabbit Polyclonal Anti-HNRPA0 Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Ku70 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
Modifications | Unmodified |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type IV purified from Human and Bovine placenta. |
YAP1 Rabbit polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
Modifications | Unmodified |
Rabbit Polyclonal H3K27me3S28p Antibody
Applications | Dot, ELISA, IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
Applications | Dot, ELISA, IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
TDH1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bakers Yeast |
Immunogen | Glyceraldehyde-3-Phosphate Dehydrogenase isolated and purified from Baker's Yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit IgG (H+L chain) goat polyclonal antibody, Aff - Purified
Applications | Immunoprecipitation, Immunodiffusion, conjugation and most immunological methods requiring lot-to-lot consistency, high titer and specificity. Recommended Dilutions: IF Microscopy. ELISA: 1/10,000-1/60,000. Western blot: 1/1,000-1/5,000. Immunohistochemistry: 1/500-1/2500. Immunoprecipitation. |
Reactivities | Rabbit |
Immunogen | Rabbit IgG whole molecule |
Rabbit Polyclonal Anti-HNRPL Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Monkey IgG (Fc specific) goat polyclonal antibody, FITC
Applications | Can be used: • In direct staining of cytoplasmic IgG in fixed Monkey cells and tissue substrates. • To identify circulating IgG antibodies in serodiagnostic microbiology and autoimmune diseases. • To identify a specific antigen or immune complex using a reference antibody of Monkey in the middle layer of the test procedure. This immunoconjugate is not pre-diluted. The optimum working dilution of each conjugate should be established by titration before being used. Excess labelled antibody must be avoided because it may cause high unspecific background staining and interfere with the specific signal. Recommended Working Dilution: 1/20-1/80. |
Reactivities | Monkey |
Conjugation | FITC |
Immunogen | Purified normal IgG isolated from pooled Rhesus Monkey serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Mouse IgG (H+L chain) sheep polyclonal antibody, Aff - Purified
Applications | Suitable for Immunoprecipitation, Immunodiffusion, conjugation and most immunological methods requiring lot-to-lot consistency, high titer and specificity. Recommended Dilutions: ELISA: 1/100,000. Western blot: 1/2,000-1/10,000. Immunohistochemistry: 1/1,000-1/5,000. |
Reactivities | Mouse |
Immunogen | Mouse IgG whole molecule. |
Hepatitis B X Protein / HBx rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IP, WB |
Immunogen | Recombinant Hepatitis B Protein X from E. coli. |
Rabbit anti-Histone H4K20me2 Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4 |
Rabbit anti-RNF2 Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RNF2 |
Rabbit Polyclonal Anti-EIF3G Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR |
Collagen III (COL3A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human |
Immunogen | Collagen Type III from Human and Bovine placenta |
Amyloid Fibrils (OC) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Fibrils prepared from Human Aß42 peptide. |
OVAL rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Chicken |
Immunogen | Ovalbumin from Hen Egg White (native protein) |
HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
HK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK1 |
Rabbit anti-ARRB1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ARRB1 |
Anti-GST rabbit polyclonal antibody
Applications | IP, WB |
Immunogen | Rabbits were immunized with recombinant Glutathione-S-transferase (GST) from E.coli . After multiple immunizations in Freund's adjuvant serum was collected. Antibodies were immunoaffinity purified using GST immobilized on a solid support. |
Rabbit Polyclonal Anti-ARF1 Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
Phospho-VASP-S157 Rabbit polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S157 of human Phospho-VASP-S157 (NP_003361.1). |
Modifications | Phospho S157 |
Caspase 1 (CASP1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide surrounding amino acid 132 of Human Caspase-1. |